Free Air: Difference between revisions

From Off the Road Database

No edit summary
Updated Page Numbers
 
(24 intermediate revisions by 3 users not shown)
Line 1: Line 1:
<meta
<meta author="Lewis, Sinclair" year_of_publication="1919" additional_information="" genre="Fiction" journal="Free Air" page_range="3-118"></meta>
  author="Lewis, Sinclair"
  year_of_publication="1919"
  additional_information="Currently, this page contains only the first chapter."
  genre="Fiction"
  journal="Free Air"
  page_range="3-10"
/>
<annotations>
<annotations>
===Chapter I===
===Chapter I===
Line 17: Line 10:
<paragraph keywords="">
<paragraph keywords="">
<poem>
<poem>
MISS BOLTWOOD OF BROOKLYN IS LOST IN THE MUD
MISS BOLTWOOD OF BROOKLYN IS LOST IN THE MUD (3-9)
</poem>
</poem>
</paragraph>
</paragraph>
Line 223: Line 216:
</poem>
</poem>
</paragraph>
</paragraph>
</annotations><annotations>
===Chapter II===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
CLAIRE ESCAPES FROM RESPECTABILITY (10-20)
</paragraph>
<paragraph keywords="">
<poem>
Claire Boltwood lived on the Heights, Brooklyn. Persons from New York and other parts of the Middlewest have been known to believe that Brooklyn is somehow humorous. In newspaper jokes and vaudeville it is so presented that people who are willing to take their philosophy from those sources believe that the leading citizens of Brooklyn are all deacons, undertakers, and obstetricians. The fact is that North Washington Square, at its reddest and whitest and fanlightedest, Gramercy Park at its most ivied, are not so aristocratic as the section of Brooklyn called the Heights. Here preached Henry Ward Beecher. Here, in mansions like mausoleums, on the ridge above docks where the good ships came sailing in from Sourabaya and Singapore, ruled the lords of a thousand sails. And still is it a place of wealth too solid to emulate the nimble self-advertising of Fifth Avenue. Here dwell the fifth-generation possessors of blocks of foundries and shipyards. Here, in a big brick house of much dignity, much ugliness, and much conservatory, lived Claire Boltwood, with her widower father.
</poem>
</paragraph>
<paragraph keywords="train">
<poem>
Henry B. Boltwood was vice-president of a firm dealing in railway supplies. He was neither wealthy nor at all poor. Every summer, despite Claire's delicate hints, they took the same cottage on the Jersey Coast, and Mr. Boltwood came down for Sunday. Claire had gone to a good school out of Philadelphia, on the Main Line. She was used to gracious leisure, attractive uselessness, nut-center chocolates, and a certain wonder as to why she was alive.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She wanted to travel, but her father could not get away. He consistently spent his days in overworking, and his evenings in wishing he hadn't overworked. He was attractive, fresh, pink-cheeked, white-mustached, and nerve-twitching with years of detail.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire's ambition had once been babies and a solid husband, but as various young males of the species appeared before her, sang their mating songs and preened their newly dry-cleaned plumage, she found that the trouble with solid young men was that they were solid. Though she liked to dance, the "dancing men" bored her. And she did not understand the district's quota of intellectuals very well; she was good at listening to symphony concerts, but she never had much luck in discussing the cleverness of the wood winds in taking up the main motif. It is history that she refused a master of arts with an old violin, a good taste in ties, and an income of eight thousand.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The only man who disturbed her was Geoffrey Saxton, known throughout the interwoven sets of Brooklyn Heights as "Jeff." Jeff Saxton was thirty-nine to Claire's twenty-three. He was clean and busy; he had no signs of vice or humor. Especially for Jeff must have been invented the symbolic morning coat, the unwrinkable gray trousers, and the moral rimless spectacles. He was a graduate of a nice college, and he had a nice tenor and a nice family and nice hands and he was nicely successful in New York copper dealing. When he was asked questions by people who were impertinent, clever, or poor, Jeff looked them over coldly before he answered, and often they felt so uncomfortable that he didn't have to answer.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The boys of Claire's own age, not long out of Yale and Princeton, doing well in business and jumping for their evening clothes daily at six-thirty, light o' loves and admirers of athletic heroes, these lads Claire found pleasant, but hard to tell apart. She didn't have to tell Jeff Saxton apart. He did his own telling. Jeff called&mdash;not too often. He sang&mdash;not too sentimentally. He took her father and herself to the theater&mdash;not too lavishly. He told Claire&mdash;in a voice not too serious&mdash;that she was his helmed Athena, his rose of all the world. He informed her of his substantial position&mdash;not too obviously. And he was so everlastingly, firmly, quietly, politely, immovably always there.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She watched the hulk of marriage drifting down on her frail speed-boat of aspiration, and steered in desperate circles.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Then her father got the nervous prostration he had richly earned. The doctor ordered rest. Claire took him in charge. He didn't want to travel. Certainly he didn't want the shore or the Adirondacks. As there was a branch of his company in Minneapolis, she lured him that far away.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Being rootedly of Brooklyn Heights, Claire didn't know much about the West. She thought that Milwaukee was the capital of Minnesota. She was not so uninformed as some of her friends, however. She had heard that in Dakota wheat was to be viewed in vast tracts&mdash;maybe a hundred acres.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Mr. Boltwood could not be coaxed to play with the people to whom his Minneapolis representative introduced him. He was overworking again, and perfectly happy. He was hoping to find something wrong with the branch house. Claire tried to tempt him out to the lakes. She failed. His nerve-fuse burnt out the second time, with much fireworks.
</poem>
</paragraph>
<paragraph keywords="driving, scenery">
<poem>
Claire had often managed her circle of girls, but it had never occurred to her to manage her executive father save by indirect and pretty teasing. Now, in conspiracy with the doctor, she bullied her father. He saw gray death waiting as alternative, and he was meek. He agreed to everything. He consented to drive with her across two thousand miles of plains and mountains to Seattle, to drop in for a call on their cousins, the Eugene Gilsons.
</poem>
</paragraph>
<paragraph keywords="driver, car model, pleasure, gender">
<poem>
Back East they had a chauffeur and two cars&mdash;the limousine, and the Gomez-Deperdussin roadster, Claire's beloved. It would, she believed, be more of a change from everything that might whisper to Mr. Boltwood of the control of men, not to take a chauffeur. Her father never drove, but she could, she insisted. His easy agreeing was pathetic. He watched her with spaniel eyes. They had the Gomez roadster shipped to them from New York.
</poem>
</paragraph>
<paragraph keywords="fog, rain, road condition, mud">
<poem>
On a July morning, they started out of Minneapolis in a mist, and as it has been hinted, they stopped sixty miles northward, in a rain, also in much gumbo. Apparently their nearest approach to the Pacific Ocean would be this oceanically moist edge of a cornfield, between Schoenstrom and Gopher Prairie, Minnesota.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
<nowiki>*****</nowiki>
</poem>
</paragraph>
<paragraph keywords="car, affect, accident">
<poem>
Claire roused from her damp doze and sighed, "Well, I must get busy and get the car out of this."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Don't you think you'd better get somebody to help us?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But get who?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Whom!"
</poem>
</paragraph>
<paragraph keywords="mud, accident, affect">
<poem>
"No! It's just 'who,' when you're in the mud. No. One of the good things about an adventure like this is that I must do things for myself. I've always had people to do things for me. Maids and nice teachers and you, old darling! I suppose it's made me soft. Soft&mdash;I would like a soft davenport and a novel and a pound of almond-brittle, and get all sick, and not feel so beastly virile as I do just now. But&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="car part, road condition, mud, equipment, accident">
<poem>
She turned up the collar of her gray tweed coat, painfully climbed out&mdash;the muscles of her back racking&mdash;and examined the state of the rear wheels. They were buried to the axle; in front of them the mud bulked in solid, shiny blackness. She took out her jack and chains. It was too late. There was no room to get the jack under the axle. She remembered from the narratives of motoring friends that brush in mud gave a firmer surface for the wheels to climb upon.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She also remembered how jolly and agreeably heroic the accounts of their mishaps had sounded&mdash;a week after they were over.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She waded down the road toward an old wood-lot. At first she tried to keep dry, but she gave it up, and there was pleasure in being defiantly dirty. She tramped straight through puddles; she wallowed in mud. In the wood-lot was long grass which soaked her stockings till her ankles felt itchy. Claire had never expected to be so very intimate with a brush-pile. She became so. As though she were a pioneer woman who had been toiling here for years, she came to know the brush stick by stick&mdash;the long valuable branch that she could never quite get out from under the others; the thorny bough that pricked her hands every time she tried to reach the curious bundle of switches.
</poem>
</paragraph>
<paragraph keywords="mud, haptic, car part, pleasure, maintenance">
<poem>
Seven trips she made, carrying armfuls of twigs and solemnly dragging large boughs behind her. She patted them down in front of all four wheels. Her crisp hands looked like the paws of a three-year-old boy making a mud fort. Her nails hurt from the mud wedged beneath them. Her mud-caked shoes were heavy to lift. It was with exquisite self-approval that she sat on the running-board, scraped a car-load of lignite off her soles, climbed back into the car, punched the starter.
</poem>
</paragraph>
<paragraph keywords="affect, accident">
<poem>
The car stirred, crept forward one inch, and settled back&mdash;one inch. The second time it heaved encouragingly but did not make quite so much headway. Then Claire did sob.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She rubbed her cheek against the comfortable, rough, heather-smelling shoulder of her father's coat, while he patted her and smiled, "Good girl! I better get out and help."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She sat straight, shook her head. "Nope. I'll do it. And I'm not going to insist on being heroic any longer. I'll get a farmer to pull us out."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
As she let herself down into the ooze, she reflected that all farmers have hearts of gold, anatomical phenomena never found among the snobs and hirelings of New York. The nearest heart of gold was presumably beating warmly in the house a quarter of a mile ahead.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She came up a muddy lane to a muddy farmyard, with a muddy cur yapping at her wet legs, and geese hissing in a pool of purest mud serene. The house was small and rather old. It may have been painted once. The barn was large and new. It had been painted very much, and in a blinding red with white trimmings. There was no brass plate on the house, but on the barn, in huge white letters, was the legend, "Adolph Zolzac, 1913."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She climbed by log steps to a narrow frame back porch littered with
parts of a broken cream-separator. She told herself that she was simple and friendly in going to the back door instead of the front, and it was with gaiety that she knocked on the ill-jointed screen door, which flapped dismally in response.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"''Ja?''" from within.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She rapped again.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"''Hinein!''"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She opened the door on a kitchen, the highlight of which was a table heaped with dishes of dumplings and salt pork. A shirt-sleeved man, all covered with mustache and calm, sat by the table, and he kept right on sitting as he inquired:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Vell?"
</poem>
</paragraph>
<paragraph keywords="car, accident, mud, road condition, skill">
<poem>
"My car&mdash;my automobile&mdash;has been stuck in the mud. A bad driver, I'm afraid! I wonder if you would be so good as to&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I usually get t'ree dollars, but I dunno as I vant to do it for less than four. Today I ain'd feelin' very goot," grumbled the golden-hearted.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire was aware that a woman whom she had not noticed&mdash;so much smaller than the dumplings, so much less vigorous than the salt pork was she&mdash;was speaking: "''Aber'', papa, dot's a shame you sharge de poor young lady dot, when she drive by ''sei'' self. Vot she t'ink of de Sherman people?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The farmer merely grunted. To Claire, "Yuh, four dollars. Dot's what I usually charge sometimes."
</poem>
</paragraph>
<paragraph keywords="road condition">
<poem>
"Usually? Do you mean to say that you leave that hole there in the road right along&mdash;that people keep on trying to avoid it and get stuck as I was? Oh! If I were an official&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Vell, I dunno, I don't guess I run my place to suit you smart alecks&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Papa! How you talk on the young lady! Make shame!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"&mdash;from the city. If you don't like it, you stay ''bei'' Mineapolis! I haul you out for t'ree dollars and a half. Everybody pay dot. Last mont' I make forty-five dollars. They vos all glad to pay. They say I help them fine. I don't see vot you're kickin' about! Oh, these vimmins!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"It's blackmail! I wouldn't pay it, if it weren't for my father sitting waiting out there. But&mdash;go ahead. Hurry!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She sat tapping her toe while Zolzac completed the stertorous task of hogging the dumplings, then stretched, yawned, scratched, and covered his merely dirty garments with overalls that were apparently woven of processed mud. When he had gone to the barn for his team, his wife came to Claire. On her drained face were the easy tears of the slave women.
</poem>
</paragraph>
<paragraph keywords="gender">
<poem>
"Oh, miss, I don't know vot I should do. My boys go on the public school, and they speak American just so goot as you. Oh, I vant man lets me luff America. But papa he says it is an ''Unsinn''; you got the money, he says, nobody should care if you are American or Old Country people. I should vish I could ride once in an automobile! But&mdash;I am so 'shamed, so 'shamed that I must sit and see my ''Mann'' make this. Forty years I been married to him, and pretty soon I die&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire patted her hand. There was nothing to say to tragedy that had outlived hope.
</poem>
</paragraph>
<paragraph keywords="animal, car part">
<poem>
Adolph Zolzac clumped out to the highroad behind his vast, rolling-flanked horses&mdash;so much cleaner and better fed than his wisp of a wife. Claire followed him, and in her heart she committed murder and was glad of it. While Mr. Boltwood looked out with mild wonder at Claire's new friend, Zolzac hitched his team to the axle. It did not seem possible that two horses could pull out the car where seventy horsepower had fainted. But, easily, yawning and thinking about dinner, the horses drew the wheels up on the mud-bank, out of the hole and
</poem>
</paragraph>
<paragraph keywords="car, accident">
<poem>
The harness broke, with a flying mess of straps and rope, and the car plumped with perfect exactness back into its bed.
</poem>
</paragraph>
</annotations><annotations>
===Chapter III===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
A YOUNG MAN IN A RAINCOAT (21-35)
</paragraph>
<paragraph keywords="car">
<poem>
"Huh! Such an auto! Look, it break my harness a'ready! Two dollar that cost you to mend it. De auto iss too heavy!" stormed Zolzac.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"All right! All right! Only for heaven's sake&mdash;go get another harness!" Claire shrieked.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Fife-fifty dot will be, in all." Zolzac grinned.
</poem>
</paragraph>
<paragraph keywords="driver, class">
<poem>
Claire was standing in front of him. She was thinking of other drivers, poor people, in old cars, who had been at the mercy of this golden-hearted one. She stared past him, in the direction from which she had come. Another motor was in sight.
</poem>
</paragraph>
<paragraph keywords="car model, affect, driver, mud, car part">
<poem>
It was a tin beetle of a car; that agile, cheerful, rut-jumping model known as a "bug"; with a home-tacked, home-painted tin cowl and tail covering the stripped chassis of a little cheap Teal car. The lone driver wore an old black raincoat with an atrocious corduroy collar, and a new plaid cap in the Harry Lauder tartan. The bug skipped through mud where the Boltwoods' Gomez had slogged and rolled. Its pilot drove up behind her car, and leaped out. He trotted forward to Claire and Zolzac. His eyes were twenty-seven or eight, but his pink cheeks were twenty, and when he smiled&mdash;shyly, radiantly&mdash;he was no age at all, but eternal boy. Claire had a blurred impression that she had seen him before, some place along the road.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Stuck?" he inquired, not very intelligently. "How much is Adolph charging you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"He wants three-fifty, and his harness broke, and he wants two dollars&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
"Oh! So he's still working that old gag! I've heard all about Adolph. He keeps that harness for pulling out cars, and it always busts. The last time, though, he only charged six bits to get it mended. Now let me reason with him."
</paragraph>
<paragraph keywords="">
<poem>
The young man turned with vicious quickness, and for the first time Claire heard pidgin German&mdash;German as it is spoken between Americans who have never learned it, and Germans who have forgotten it:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"''Schon sex'' hundred times ''Ich höre'' all about the way you been doing autos, Zolzac, you ''verfluchter Schweinhund'', and I'll set the sheriff on you&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Dot ain'd true, maybe ''einmal die Woche kommt'' somebody and ''Ich muss die Arbeit immer lassen und in die Regen ausgehen, und seh' mal'' how ''die'' boots ''sint mit'' mud covered, two dollars it don't pay for dis boots&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Now that's enough-plenty out of you, ''seien die'' boots ''verdammt'', and ''mach' dass du fort gehst''&mdash;muddy boots, hell!&mdash;put ''mal ein'' egg in ''die'' boots and beat it, ''verleicht'' maybe I'll by golly arrest you myself, ''weiss du''! I'm a special deputy sheriff."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The young man stood stockily. He seemed to swell as his somewhat muddy hand was shaken directly at, under, and about the circumference of, Adolph Zolzac's hairy nose. The farmer was stronger, but he retreated. He took up the reins. He whined, "Don't I get nothing I break de harness?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Sure. You get ten&mdash;years! And you get out!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
From thirty yards up the road, Zolzac flung back, "You t'ink you're pretty damn smart!" That was his last serious reprisal.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Clumsily, as one not used to it, the young man lifted his cap to Claire, showing straight, wiry, rope-colored hair, brushed straight back from a rather fine forehead. "Gee, I was sorry to have to swear and holler like that, but it's all Adolph understands. Please don't think there's many of the folks around here like him. They say he's the meanest man in the county."
</poem>
</paragraph>
<paragraph keywords="car, mud">
<poem>
"I'm immensely grateful to you, but&mdash;do you know much about motors? How can I get out of this mud?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She was surprised to see the youngster blush. His clear skin flooded. His engaging smile came again, and he hesitated, "Let me pull you out."
</poem>
</paragraph>
<paragraph keywords="car model, metaphor">
<poem>
She looked from her hulking car to his mechanical flea.
</poem>
</paragraph>
<paragraph keywords="mud, equipment">
<poem>
He answered the look: "I can do it all right. I'm used to the gumbo&mdash;regular mud-hen. Just add my power to yours. Have you a tow-rope?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No. I never thought of bringing one."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'll get mine."
</poem>
</paragraph>
<paragraph keywords="car model, car part, pleasure, metaphor, animal">
<poem>
She walked with him back toward his bug. It lacked not only top and side-curtains, but even windshield and running-board. It was a toy&mdash;a card-board box on toothpick axles. Strapped to the bulging back was a wicker suitcase partly covered by tarpaulin. From the seat peered a little furry face.
</poem>
</paragraph>
<paragraph keywords="animal, car part, equipment">
<poem>
"A cat?" she exclaimed, as he came up with a wire rope, extracted from the tin back.
</poem>
</paragraph>
<paragraph keywords="driver, metaphor, animal">
<poem>
"Yes. She's the captain of the boat. I'm just the engineer."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"What is her name?"
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
Before he answered the young man strode ahead to the front of her car, Claire obediently trotting after him. He stooped to look at her front axle. He raised his head, glanced at her, and he was blushing again.
</poem>
</paragraph>
<paragraph keywords="driver, skill, car model, road condition">
<poem>
"Her name is Vere de Vere!" he confessed. Then he fled back to his bug. He drove it in front of the Gomez-Dep. The hole in the road itself was as deep as the one on the edge of the cornfield, where she was stuck, but he charged it. She was fascinated by his skill. Where she would for a tenth of a second have hesitated while choosing the best course, he hurled the bug straight at the hole, plunged through with sheets of glassy black water arching on either side, then viciously twisted the car to the right, to the left, and straight again, as he followed the tracks with the solidest bottoms.
</poem>
</paragraph>
<paragraph keywords="car part, mud">
<poem>
Strapped above the tiny angle-iron step which replaced his running-board was an old spade. He dug channels in front of the four wheels of her car, so that they might go up inclines, instead of pushing against the straight walls of mud they had thrown up. On these inclines he strewed the brush she had brought, halting to ask, with head alertly lifted from his stooped huddle in the mud, "Did you have to get this brush yourself?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes. Horrid wet!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He merely shook his head in commiseration.
</poem>
</paragraph>
<paragraph keywords="equipment, car part">
<poem>
He fastened the tow-rope to the rear axle of his car, to the front of hers. "Now will you be ready to put on all your power as I begin to pull?" he said casually, rather respectfully.
</poem>
</paragraph>
<paragraph keywords="car model, car part, equipment, pleasure, road condition, driving">
<poem>
When the struggling bug had pulled the wire rope taut, she opened the throttle. The rope trembled. Her car seemed to draw sullenly back. Then it came out&mdash;out&mdash;really out, which is the most joyous sensation any motorist shall ever know. In excitement over actually moving again, as fast as any healthy young snail, she drove on, on, the young man ahead grinning back at her. Nor did she stop, nor he, till both cars were safe on merely thick mud, a quarter of a mile away.
</poem>
</paragraph>
<paragraph keywords="equipment, car model">
<poem>
She switched off the power&mdash;and suddenly she was in a whirlwind of dizzy sickening tiredness. Even in her abandonment to exhaustion she noticed that the young man did not stare at her but, keeping his back to her, removed the tow-rope, and stowed it away in his bug. She wondered whether it was tact or yokelish indifference.
</poem>
</paragraph>
<paragraph keywords="metaphor, car model">
<poem>
Her father spoke for the first time since the Galahad of the tin bug had come: "How much do you think we ought to give this fellow?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Now of all the cosmic problems yet unsolved, not cancer nor the future of poverty are the flustering questions, but these twain: Which is worse, not to wear evening clothes at a party at which you find every one else dressed, or to come in evening clothes to a house where, it proves, they are never worn? And: Which is worse, not to tip when a tip has been expected; or to tip, when the tip is an insult?
</poem>
</paragraph>
<paragraph keywords="">
<poem>
In discomfort of spirit and wetness of ankles Claire shuddered, "Oh dear, I don't believe he expects us to pay him. He seems like an awfully independent person. Maybe we'd offend him if we offered&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"The only reasonable thing to be offended at in this vale of tears is not being offered money!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Just the same&mdash;&mdash; Oh dear, I'm so tired. But good little Claire will climb out and be diplomatic."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She pinched her forehead, to hold in her cracking brain, and wabbled out into new scenes of mud and wetness, but she came up to the young man with the most rain-washed and careless of smiles. "Won't you come back and meet my father? He's terribly grateful to you&mdash;as I am. And may we&mdash;&mdash; You've worked so hard, and about saved our lives. May I pay you for that labor? We're really much indebted&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, it wasn't anything. Tickled to death if I could help you."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He heartily shook hands with her father, and he droned, "Pleased to meet you, Mr. Uh."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Boltwood."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Mr. Boltwood. My name is Milt&mdash;Milton Daggett. See you have a New York license on your car. We don't see but mighty few of those through here. Glad I could help you."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Ah yes, Mr. Daggett." Mr. Boltwood was uninterestedly fumbling in his money pocket. Behind Milt Daggett, Claire shook her head wildly, rattling her hands as though she were playing castanets. Mr. Boltwood shrugged. He did not understand. His relations with young men in cheap raincoats were entirely monetary. They did something for you, and you paid them&mdash;preferably not too much&mdash;and they ceased to be. Whereas Milt Daggett respectfully but stolidly continued to be, and Mr. Henry Boltwood's own daughter was halting the march of affairs by asking irrelevant questions:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Didn't we see you back in&mdash;what was that village we came through back about twelve miles?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Schoenstrom?" suggested Milt.
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
"Yes, I think that was it. Didn't we pass you or something? We stopped at a garage there, to change a tire."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I don't think so. I was in town, though, this morning. Say, uh, did you and your father grab any eats&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"A&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I mean, did you get dinner there?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No. I wish we had!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well say, I didn't either, and&mdash;I'd be awfully glad if you folks would have something to eat with me now."
</poem>
</paragraph>
<paragraph keywords="driver, driving, car model">
<poem>
Claire tried to give him a smile, but the best she could do was to lend him one. She could not associate interesting food with Milt and his mud-slobbered, tin-covered, dun-painted Teal bug. He seemed satisfied with her dubious grimace. By his suggestion they drove ahead to a spot where the cars could be parked on firm grass beneath oaks. On the way, Mr. Boltwood lifted his voice in dismay. His touch of nervous prostration had not made him queer or violent; he retained a touching faith in good food.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"We might find some good little hotel and have some chops and just some mushrooms and peas," insisted the man from Brooklyn Heights.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I don't suppose the country hotels are really so awfully good," she speculated. "And look&mdash;that nice funny boy. We couldn't hurt his feelings. He's having so much fun out of being a Good Samaritan."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
From the mysterious rounded back of his car Milt Daggett drew a tiny stove, to be heated by a can of solidified alcohol, a frying pan that was rather large for dolls but rather small for square-fingered hands, a jar of bacon, eggs in a bag, a coffee pot, a can of condensed milk, and a litter of unsorted tin plates and china cups. While, by his request, Claire scoured the plates and cups, he made bacon and eggs and coffee, the little stove in the bottom of his car sheltered by the cook's bending over it. The smell of food made Claire forgiving toward the fact that she was wet through; that the rain continued to drizzle down her neck.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He lifted his hand and demanded, "Take your shoes off!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Uh?"
</poem>
</paragraph>
<paragraph keywords="engine, driving, mud, car part">
<poem>
He gulped. He stammered, "I mean&mdash;I mean your shoes are soaked through. If you'll sit in the car, I'll put your shoes up by the engine. It's pretty well heated from racing it in the mud. You can get your stockings dry under the cowl."
</poem>
</paragraph>
<paragraph keywords="car part, car model, metaphor">
<poem>
She was amused by the elaborateness with which he didn't glance at her while she took off her low shoes and slipped her quite too thin black stockings under the protecting tin cowl. She reflected, "He has such a nice, awkward gentleness. But such bad taste! They're really quite good ankles. Apparently ankles are not done, in Teal bug circles. His sisters don't even have limbs. But do fairies have sisters? He is a fairy. When I'm out of the mud he'll turn his raincoat into a pair of lordly white wings, and vanish. But what will become of the cat?"
</poem>
</paragraph>
<paragraph keywords="car, rain, affect">
<poem>
Thus her tired brain, like a squirrel in a revolving cage, while she sat primly and scraped at a clot of rust on a tin plate and watched him put on the bacon and eggs. Wondering if cats were used for this purpose in the Daggett family, she put soaked, unhappy Vere de Vere on her feet, to her own great comfort and the cat's delight. It was an open car, and the rain still rained, and a strange young man was a foot from her tending the not very crackly fire, but rarely had Claire felt so domestic.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt was apparently struggling to say something. After several bobs of his head he ventured, "You're so wet! I'd like for you to take my raincoat."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No! Really! I'm already soaked through. You keep dry."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He was unhappy about it. He plucked at a button of the coat. She turned him from the subject. "I hope Lady Vere de Vere is getting warm, too."
</poem>
</paragraph>
<paragraph keywords="car, animal">
<poem>
"Seems to be. She's kind of demanding. She wanted a little car of her own, but I didn't think she could keep up with me, not on a long hike."
</poem>
</paragraph>
<paragraph keywords="car, car part, animal">
<poem>
"A little car? With her paws on the tiny wheel? Oh&mdash;sweet! Are you going far, Mr. Daggett?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes, quite a ways. To Seattle, Washington."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, really? Extraordinary. We're going there, too."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Honest? You driving all the way? Oh, no, of course your father&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No, he doesn't drive. By the way, I hope he isn't too miserable back there."
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
"I'll be darned. Both of us going to Seattle. That's what they call a coincidence, isn't it! Hope I'll see you on the road, some time. But I don't suppose I will. Once you're out of the mud, your Gomez will simply lose my Teal."
</poem>
</paragraph>
<paragraph keywords="skill, driver">
<poem>
"Not necessarily. You're the better driver. And I shall take it easy. Are you going to stay long in Seattle?" It was not merely a polite dinner-payment question. She wondered; she could not place this fresh-cheeked, unworldly young man so far from his home.
</poem>
</paragraph>
<paragraph keywords="train, metaphor, resources, gasoline">
<poem>
"Why, I kind of hope&mdash;&mdash; Government railroad, Alaska. I'm going to try to get in on that, somehow. I've never been out of Minnesota in my life, but there's couple mountains and oceans and things I thought I'd like to see, so I just put my suitcase and Vere de Vere in the machine, and started out. I burn distillate instead of gas, so it doesn't cost much. If I ever happen to have five whole dollars, why, I might go on to Japan!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"That would be jolly."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Though I s'pose I'd have to eat&mdash;what is it?&mdash;pickled fish? There's a woman from near my town went to the Orient as a missionary. From what she says, I guess all you need in Japan to make a house is a bottle of mucilage and a couple of old newspapers and some two-by-fours. And you can have the house on a purple mountain, with cherry trees down below, and&mdash;&mdash;" He put his clenched hand to his lips. His head was bowed. "And the ocean! Lord! The ocean! And we'll see it at Seattle. Bay, anyway. And steamers there&mdash;just come from India! Huh! Getting pretty darn
poetic here! Eggs are done."
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
The young man did not again wander into visions. He was all briskness as he served her bacon and eggs, took a plate of them to Mr. Boltwood in the Gomez, gouged into his own. Having herself scoured the tin plates, Claire was not repulsed by their naked tinniness; and the coffee in the broken-handled china cup was tolerable. Milt drank from the top of a vacuum bottle. He was silent. Immediately after the lunch he stowed the things away. Claire expected a drawn-out, tact-demanding farewell, but he climbed into his bug, said "Good-by, Miss Boltwood. Good luck!" and
was gone.
</poem>
</paragraph>
<paragraph keywords="rain, road condition">
<poem>
The rainy road was bleakly empty without him.
</poem>
</paragraph>
<paragraph keywords="car model, pleasure, driver, skill">
<poem>
It did not seem possible that Claire's body could be nagged into going on any longer. Her muscles were relaxed, her nerves frayed. But the moment the Gomez started, she discovered that magic change which every long-distance motorist knows. Instantly she was alert, seemingly able to drive forever. The pilot's instinct ruled her; gave her tireless eyes and sturdy hands. Surely she had never been weary; never would be, so long as it was hers to keep the car going.
</poem>
</paragraph>
<paragraph keywords="road condition, mud, truck">
<poem>
She had driven perhaps six miles when she reached a hamlet called St. Klopstock. On the bedraggled mud-and-shanty main street a man was loading crushed rock into a truck. By him was a large person in a prosperous raincoat, who stepped out, held up his hand. Claire stopped.
</poem>
</paragraph>
<paragraph keywords="accident, road condition">
<poem>
"You the young lady that got stuck in that hole by Adolph Zolzac's?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes. And Mr. Zolzac wasn't very nice about it."
</poem>
</paragraph>
<paragraph keywords="mud, road condition, accident">
<poem>
"He's going to be just elegant about it, now, and there ain't going to be any more hole. I think Adolph has been keeping it muddy&mdash;throwing in soft dirt&mdash;and he made a good and plenty lot out of pulling out tourists. Bill and I are going down right now and fill it up with stone. Milt Daggett come through here&mdash;he's got a nerve, that fellow, but I did have to laugh&mdash;he says to me, 'Barney&mdash;&mdash;' This was just now. He hasn't more than just drove out of town. He said to me, 'Barney,' he says, 'you're the richest man in this township, and the banker, and you got a big car y'self, and you think you're one whale of a political boss,' he says, 'and yet you let that Zolzac maintain a private ocean, against the peace and damn horrible inconvenience of the Commonwealth of Minnesota&mdash;&mdash;' He's got a great line of talk, that fellow. He told me how you got stuck&mdash;made me so ashamed&mdash;I been to New York myself&mdash;and right away I got Bill, and we're going down and hold a donation and surprise party on Adolph and fill that hole."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But won't Adolph dig it out again?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The banker was puffy, but his eyes were of stone. From the truck he took a shotgun. He drawled, "In that case, the surprise party will include an elegant wake."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But how did&mdash;&mdash; Who is this extraordinary Milt Daggett?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Him? Oh, nobody 'specially. He's just a fellow down here at Schoenstrom. But we all know him. Goes to all the dances, thirty miles around. Thing about him is: if he sees something wrong, he picks out some poor fellow like me, and says what he thinks."
</poem>
</paragraph>
<paragraph keywords="driving, car model">
<poem>
Claire drove on. She was aware that she was looking for Milt's bug. It was not in sight.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Father," she exclaimed, "do you realize that this lad didn't tell us he was going to have the hole filled? Just did it. He frightens me. I'm afraid that when we reach Gopher Prairie for the night, we'll find he has engaged for us the suite that Prince Collars and Cuffs once slept in."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Hhhhmm," yawned her father.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Curious young man. He said, 'Pleased to meet you.'"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Huuuuhhm! Fresh air makes me so sleepy."
</poem>
</paragraph>
<paragraph keywords="skill, class">
<poem>
"And&mdash;&mdash; Fooled you! Got through that mudhole, anyway! And he said&mdash;&mdash; Look! Fields stretch out so here, and not a tree except the willow-groves round those farmhouses. And he said 'Gee' so many times, and 'dinner' for the noon meal. And his nails&mdash;&mdash; No, I suppose he really is just a farm youngster."
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
Mr. Boltwood did not answer. His machine-finish smile indicated an enormous lack of interest in young men in Teal bugs.
</poem>
</paragraph>
</annotations><annotations>
===Chapter IV===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
A ROOM WITHOUT (36-48)
</paragraph>
<paragraph keywords="">
<poem>
Gopher Prairie has all of five thousand people. Its commercial club asserts that it has at least a thousand more population and an infinitely better band than the ridiculously envious neighboring town of Joralemon. But there were few signs that a suite had been engaged for the Boltwoods, or that Prince Collars and Cuffs had on his royal tour of America spent much time in Gopher Prairie. Claire reached it somewhat before seven. She gaped at it in a hazy way. Though this was her first prairie town for a considerable stay, she could not pump up interest.
</poem>
</paragraph>
<paragraph keywords="driver, metaphor, affect">
<poem>
The state of mind of the touring motorist entering a strange place at night is as peculiar and definite as that of a prospector. It is compounded of gratitude at having got safely in; of perception of a new town, yet with all eagerness about new things dulled by weariness; of hope that there is going to be a good hotel, but small expectation&mdash;and absolutely no probability&mdash;that there really will be one.
</poem>
</paragraph>
<paragraph keywords="mud, road condition, skill, car model, personification, visibility, garage">
<poem>
Claire had only a blotched impression of peaked wooden buildings and squatty brick stores with faded awnings; of a red grain elevator and a crouching station and a lumberyard; then of the hopelessly muddy road leading on again into the country. She felt that if she didn't stop at once, she would miss the town entirely. The driving-instinct sustained her, made her take corners sharply, spot a garage, send the Gomez whirling in on the cement floor.
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
The garage attendant looked at her and yawned.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Where do you want the car?" Claire asked sharply.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, stick it in that stall," grunted the man, and turned his back.
</poem>
</paragraph>
<paragraph keywords="car part, parking, affect">
Claire glowered at him. She thought of a good line about rudeness.
But&mdash;oh, she was too tired to fuss. She tried to run the car into the empty stall, which was not a stall, but a space, like a missing tooth, between two cars, and so narrow that she was afraid of crumpling the lordly fenders of the Gomez. She ran down the floor, returned with a flourish, thought she was going to back straight into the stall&mdash;and found she wasn't. While her nerves shrieked, and it did not seem possible that she could change gears, she managed to get the Gomez behind a truck and side-on to the stall.
</paragraph>
<paragraph keywords="parking, car part">
<poem>
"Go forward again, and cramp your wheel&mdash;sharp!" ordered the garage man.
</poem>
</paragraph>
<paragraph keywords="affect, parking">
<poem>
Claire wanted to outline what she thought of him, but she merely demanded, "Will you kindly drive it in?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why, sure. You bet," said the man casually. His readiness ruined her inspired fury. She was somewhat disappointed.
</poem>
</paragraph>
<paragraph keywords="car part, driver, affect">
<poem>
As she climbed out of the car and put a hand on the smart bags strapped on a running-board, the accumulated weariness struck her in a shock. She could have driven on for hours, but the instant the car was safe for the night, she went to pieces. Her ears rang, her eyes were soaked in fire, her mouth was dry, the back of her neck pinched. It was her father who took the lead as they rambled to the one tolerable hotel in the town.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
In the hotel Claire was conscious of the ugliness of the poison-green walls and brass cuspidors and insurance calendars and bare floor of the office; conscious of the interesting scientific fact that all air had been replaced by the essence of cigar smoke and cooking cabbage; of the stares of the traveling men lounging in bored lines; and of the lack of welcome on the part of the night clerk, an oldish, bleached man with whiskers instead of a collar.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She tried to be important: "Two rooms with bath, please."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The bleached man stared at her, and shoved forward the register and a pen clotted with ink. She signed. He took the bags, led the way to the stairs. Anxiously she asked, "Both rooms are with bath?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
From the second step the night clerk looked down at her as though she were a specimen that ought to be pinned on the corks at once, and he said loudly, "No, ma'am. Neither of 'em. Got no rooms vacant with bawth, or bath either! Not but what we got 'em in the house. This is an up-to-date place. But one of 'm's took, and the other has kind of been out of order, the last three-four months."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
From the audience of drummers below, a delicate giggle.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire was too angry to answer. And too tired. When, after miles of stairs, leagues of stuffy hall, she reached her coop, with its iron bed so loose-jointed that it rattled to a breath, its bureau with a list to port, and its anemic rocking-chair, she dropped on the bed, panting, her eyes closed but still brimming with fire. It did not seem that she could ever move again. She felt chloroformed. She couldn't even coax herself off the bed, to see if her father was any better off in the next room.
</poem>
</paragraph>
<paragraph keywords="driver, train, bus, affect">
<poem>
She was certain that she was not going to drive to Seattle. She wasn't going to drive anywhere! She was going to freight the car back to Minneapolis, and herself go back by train&mdash;Pullman!&mdash;drawing-room!
</poem>
</paragraph>
<paragraph keywords="">
<poem>
But for the thought of her father she would have fallen asleep, in her drenched tweeds. When she did force the energy to rise, she had to support herself by the bureau, by the foot of the bed, as she moved about the room, hanging up the wet suit, rubbing herself with a slippery towel, putting on a dark silk frock and pumps. She found her father sitting motionless in his room, staring at the wall. She made herself laugh at him for his gloomy emptiness. She paraded down the hall with him.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
As they reached the foot of the stairs, the old one, the night clerk leaned across the desk and, in a voice that took the whole office into the conversation, quizzed, "Come from New York, eh? Well, you're quite a ways from home."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire nodded. She felt shyer before these solemnly staring traveling men than she ever had in a box at the opera. At the double door of the dining-room, from which the cabbage smell steamed with a lustiness undiminished by the sad passing of its youth, a man, one of the average-sized, average-mustached, average business-suited, average-brown-haired men who can never be remembered, stopped the Boltwoods and hawed, "Saw you coming into town. You've got a New York license?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She couldn't deny it.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Quite a ways from home, aren't you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She had to admit it.
</poem>
</paragraph>
<paragraph keywords="car, driving">
<poem>
She was escorted by a bouncing, black-eyed waitress to a table for four. The next table was a long one, at which seven traveling men, or local business men whose wives were at the lake for the summer, ceased trying to get nourishment out of the food, and gawped at her. Before the Boltwoods were seated, the waitress dabbed at non-existent spots on their napkins, ignored a genuine crumb on the cloth in front of Claire's plate, made motions at a cup and a formerly plated fork, and bubbled, "Autoing through?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire fumbled for her chair, oozed into it, and breathed, "Yes."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Going far?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Where do you live?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"New York."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"My! You're quite a ways from home, aren't you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Apparently."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Hamnegs roasbeef roaspork thapplesauce frypickerel springlamintsauce."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I&mdash;I beg your pardon."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The waitress repeated.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I&mdash;oh&mdash;oh, bring us ham and eggs. Is that all right, father?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh&mdash;no&mdash;well&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You wanted same?" the waitress inquired of Mr. Boltwood.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He was intimidated. He said, "If you please," and feebly pawed at a
fork.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The waitress was instantly back with soup, and a collection of china gathered by a man of much travel, catholic interests, and no taste. One of the plates alleged itself to belong to a hotel in Omaha. She pushed a pitcher of condensed milk to the exact spot where it would catch Mr. Boltwood's sleeve, brushed the crumb from in front of Claire to a shelter beneath the pink and warty sugar bowl, recovered a toothpick which had been concealed behind her glowing lips, picked for a while, gave it up, put her hands on her hips, and addressed Claire:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"How far you going?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"To Seattle."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Got any folks there?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Any&mdash;&mdash; Oh, yes, I suppose so."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Going to stay there long?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Really&mdash;&mdash; We haven't decided."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Come from New York, eh? Quite a ways from home, all right. Father in business there?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"What's his line?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I beg pardon?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"What's his line? Ouch! Jiminy, these shoes pinch my feet. I used to could dance all night, but I'm getting fat, I guess, ha! ha! Put on seven pounds last month. Ouch! Gee, they certainly do pinch my toes. What business you say your father's in?"
</poem>
</paragraph>
<paragraph keywords="train">
<poem>
"I didn't say, but&mdash;&mdash; Oh, railroad."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"G. N. or N. P.?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I don't think I quite understand&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Mr. Boltwood interposed, "Are the ham and eggs ready?"
</poem>
</paragraph>
<paragraph keywords="driver">
<poem>
"I'll beat it out and see." When she brought them, she put a spoon in Claire's saucer of peas, and demanded, "Say, you don't wear that silk dress in the auto, do you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I should think you'd put a pink sash on it. Seems like it's kind of plain&mdash;it's a real pretty piece of goods, though. A pink sash would be real pretty. You dark-complected ladies always looks better for a touch of color."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Then was Claire certain that the waitress was baiting her, for the amusement of the men at the long table. She exploded. Probably the waitress did not know there had been an explosion when Claire looked coldly up, raised her brows, looked down, and poked the cold and salty slab of ham, for she was continuing:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"A light-complected lady like me don't need so much color, you notice my hair is black, but I'm light, really, Pete Liverquist says I'm a blonde brunette, gee, he certainly is killing that fellow, oh, he's a case, he sure does like to hear himself talk, my! there's Old Man Walters, he runs the telephone exchange here, I heard he went down to St. Cloud on Number 2, but I guess he couldn't of, he'll be yodeling for friend soup and a couple slabs of moo, I better beat it, I'll say so, so long."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire's comment was as acid as the pale beets before her, as bitter as the peas, as hard as the lumps in the watery mashed potatoes:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I don't know whether the woman is insane or ignorant. I wish I could tell whether she was trying to make me angry for the benefit of those horrid unshaven men, or merely for her private edification."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"By me, dolly. So is this pie. Let's get some medium to levitate us up to bed. Uh&mdash;uh&mdash;&mdash; I think perhaps we'd better not try to drive clear to Seattle. If we just went through to Montana?&mdash;or even just to Bismarck?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Drive through with the hotels like this? My dear man, if we have one more such day, we stop right there. I hope we get by the man at the desk. I have a feeling he's lurking there, trying to think up something insulting to say to us. Oh, my dear, I hope you aren't as beastly tired as I am. My bones are hot pokers."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The man at the desk got in only one cynical question, "Driving far?" before Claire seized her father's arm and started him upstairs.
</poem>
</paragraph>
<paragraph keywords="driver, affect, road">
<poem>
For the first time since she had been ten&mdash;and in a state of naughtiness immediately following a pronounced state of grace induced by the pulpit oratory of the new rector of St. Chrysostom's&mdash;she permitted herself the luxury of not stopping to brush her teeth before she went to bed. Her sleep was drugged&mdash;it was not sleep, but an aching exhaustion of the body which did not prevent her mind from revisualizing the road, going stupidly over the muddy stretches and sharp corners, then becoming conscious of that bed, the lump under her shoulder blades, the slope to westward, and the creak that rose every time she tossed. For at least fifteen minutes she lay awake for hours.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Thus Claire Boltwood's first voyage into democracy.
</poem>
</paragraph>
<paragraph keywords="driver, affect, gender, road condition, mud">
<poem>
It was not so much that the sun was shining, in the morning, as that a ripple of fresh breeze came through the window. She discovered that she again longed to go on&mdash;keep going on&mdash;see new places, conquer new roads. She didn't want all good road. She wanted something to struggle against. She'd try it for one more day. She was stiff as she crawled out of bed, but a rub with cold water left her feeling that she was stronger than she ever had been; that she was a woman, not a dependent girl. Already, in the beating prairie sun-glare, the wide main street of Gopher Prairie was drying; the mud ruts flattening out. Beyond the town hovered the note of a meadow lark&mdash;sunlight in sound.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, it's a sweet morning! Sweet! We will go on! I'm terribly excited!" she laughed.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She found her father dressed. He did not know whether or not he wanted to go on. "I seem to have lost my grip on things. I used to be rather decisive. But we'll try it one more day, if you like," he said.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
When she had gaily marched him downstairs, she suddenly and unhappily remembered the people she would have to face, the gibing questions she would have to answer.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The night clerk was still at the desk, as though he had slept standing. He hailed them. "Well, well! Up bright and early! Hope you folks slept well. Beds aren't so good as they might be, but we're kind of planning to get some new mattresses. But you get pretty good air to sleep in. Hope you have a fine hike today."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
His voice was cordial; he was their old friend; faithful watcher of their progress. Claire found herself dimpling at him.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
In the dining-room their inquisitional acquaintance, the waitress, fairly ran to them. "Sit down, folks. Waffles this morning. You want to stock up for your drive. My, ain't it an elegant morning! I hope you have a swell drive today!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why!" Claire gasped, "why, they aren't rude. They care&mdash;about people they never saw before. That's why they ask questions! I never thought&mdash;I never thought! There's people in the world who want to know us without having looked us up in the Social Register! I'm so ashamed! Not that the sunshine changes my impression of this coffee. It's frightful! But that will improve. And the people&mdash;they were being friendly, all the time. Oh, Henry B., young Henry Boltwood, you and your godmother Claire have a lot to learn about the world!"
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
As they came into the garage, their surly acquaintance of the night before looked just as surly, but Claire tried a boisterous "Good morning!"
</poem>
</paragraph>
<paragraph keywords="parking">
<poem>
"Mornin'! Going north? Better take the left-hand road at Wakamin. Easier going. Drive your car out for you?"
</poem>
</paragraph>
<paragraph keywords="gasoline, gas station">
<poem>
As the car stood outside taking on gas, a man flapped up, spelled out the New York license, looked at Claire and her father, and inquired, "Quite a ways from home, aren't you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
This time Claire did not say "Yes!" She experimented with, "Yes, quite a ways."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well, hope you have a good trip. Good luck!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire leaned her head on her hand, thought hard. "It's I who wasn't friendly," she propounded to her father. "How much I've been losing. Though I still refuse to like that coffee!"
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
She noticed the sign on the air-hose of the garage&mdash;"Free Air."
</poem>
</paragraph>
<paragraph keywords="religion, metaphor">
<poem>
"There's our motto for the pilgrimage!" she cried.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She knew the exaltation of starting out in the fresh morning for places she had never seen, without the bond of having to return at night.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Thus Claire's second voyage into democracy.
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
While she was starting the young man who had pulled her out of the mud and given her lunch was folding up the tarpaulin and blankets on which he had slept beside his Teal bug, in the woods three miles north of Gopher Prairie. To the high-well-born cat, Vere de Vere, Milt Daggett mused aloud, "Your ladyship, as Shakespeare says, the man that gets cold feet never wins the girl. And I'm scared, cat, clean scared."
</poem>
</paragraph>
</annotations><annotations>
===Chapter V===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
RELEASE BRAKES&mdash;SHIFT TO THIRD (49-65)
</paragraph>
<paragraph keywords="garage">
<poem>
Milt Daggett had not been accurate in his implication that he had not noticed Claire at a garage in Schoenstrom. For one thing, he owned the garage.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt was the most prosperous young man in the village of Schoenstrom. Neither the village itself nor the nearby ''Strom'' is really ''schoen''. The entire business district of Schoenstrom consists of Heinie Rauskukle's general store, which is brick; the Leipzig House, which is frame; the Old Home Poolroom and Restaurant, which is of old logs concealed by a frame sheathing; the farm-machinery agency, which is galvanized iron, its roof like an enlarged washboard; the church; the three saloons; and the Red Trail Garage, which is also, according to various signs, the Agency for Teal Car Best at the Test, Stonewall Tire Service Station, Sewing Machines and Binders Repaired, Dr. Hostrum the Veterinarian every Thursday, Gas Today 27c.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The Red Trail Garage is of cement and tapestry brick. In the office is a clean hardwood floor, a typewriter, and a picture of Elsie Ferguson. The establishment has an automatic rim-stretcher, a wheel jack, and a reputation for honesty.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The father of Milt Daggett was the Old Doctor, born in Maine, coming to this frontier in the day when Chippewas camped in your dooryard, and came in to help themselves to coffee, which you made of roasted corn. The Old Doctor bucked northwest blizzards, read Dickens and Byron, pulled people through typhoid, and left to Milt his shabby old medicine case and thousands of dollars&mdash;in uncollectible accounts. Mrs. Daggett had long since folded her crinkly hands in quiet death.
</poem>
</paragraph>
<paragraph keywords="car model, garage">
<poem>
Milt had covered the first two years of high school by studying with the priest, and been sent to the city of St. Cloud for the last two years. His father had meant to send him to the state university. But Milt had been born to a talent for machinery. At twelve he had made a telephone that worked. At eighteen he was engineer in the tiny flour mill in Schoenstrom. At twenty-five, when Claire Boltwood chose to come tearing through his life in a Gomez-Dep, Milt was the owner, manager, bookkeeper, wrecking crew, ignition expert, thoroughly competent bill-collector, and all but one of the working force of the Red Trail Garage.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
There were two factions in Schoenstrom: the retired farmers who said that German was a good enough language for anybody, and that taxes for schools and sidewalks were yes something crazy; and the group who stated that a pig-pen is a fine place, but only for pigs. To this second, revolutionary wing belonged a few of the first generation, most of the second, and all of the third; and its leader was Milt Daggett. He did not talk much, normally, but when he thought things ought to be done, he was as annoying as a machine-gun test in the lot next to a Quaker meeting.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
If there had been a war, Milt would probably have been in it&mdash;rather casual, clearing his throat, reckoning and guessing that maybe his men might try going over and taking that hill ... then taking it. But all of this history concerns the year just before America spoke to Germany; and in this town buried among the cornfields and the wheat, men still thought more about the price of grain than about the souls of nations.
</poem>
</paragraph>
<paragraph keywords="garage">
On the evening before Claire Boltwood left Minneapolis and adventured into democracy, Milt was in the garage. He wore union overalls that were tan where they were not grease-black; a faded blue cotton shirt; and the crown of a derby, with the rim not too neatly hacked off with a dull toad-stabber jack-knife.
</paragraph>
<paragraph keywords="mechanic, car model">
<poem>
Milt smiled at his assistant, Ben Sittka, and suggested, "Well, ''wie geht 's mit'' the work, eh? Like to stay and get the prof's flivver out, so he can have it in the morning?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You bet, boss."
</poem>
</paragraph>
<paragraph keywords="mechanic">
<poem>
"Getting to be quite a mechanic, Ben."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'll say so!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"If you get stuck, come yank me out of the Old Home."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Aw rats, boss. I'll finish it. You beat it." Ben grinned at Milt
adoringly.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt stripped off his overalls and derby-crown, and washed his big, firm hands with gritty soft soap. He cleaned his nails with a file which he carried in his upper vest pocket in a red imitation morocco case which contained a comb, a mirror, an indelible pencil, and a note-book with the smudged pencil addresses of five girls in St. Cloud, and a memorandum about Rauskukle's car.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He put on a twisted brown tie, an old blue serge suit, and a hat which, being old and shabby, had become graceful. He ambled up the street. He couldn't have ambled more than three blocks and have remained on the street. Schoenstrom tended to leak off into jungles of tall corn.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Two men waved at him, and one demanded, "Say, Milt, is whisky good for the toothache? What d' you think! The doc said it didn't do any good. But then, gosh, he's only just out of college."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I guess he's right."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Is that a fact! Well, I'll keep off it then."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Two stores farther on, a bulky farmer hailed, "Say, Milt, should I get an ensilage cutter yet?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yuh," in the manner of a man who knows too much to be cocksure about anything, "I don't know but what I would, Julius."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I guess I vill then."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Minnie Rauskukle, plump, hearty Minnie, heiress to the general store, gave evidence by bridling and straightening her pigeon-like body that she was aware of Milt behind her. He did not speak to her. He ducked into the door of the Old Home Poolroom and Restaurant.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt ranged up to the short lunch counter, in front of the pool table where two brick-necked farm youngsters were furiously slamming balls and attacking cigarettes. Loose-jointedly Milt climbed a loose-jointed high stool and to the proprietor, Bill McGolwey, his best friend, he yawned, "You might poison me with a hamburger and a slab of apple, Mac."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'll just do that little thing. Look kind of grouchy tonight, Milt."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Too much excitement in this burg. Saw three people on the streets all simultaneously to-once."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"What's been eatin' you lately?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Me? Nothing. Only I do get tired of this metropolis. One of these days I'm going to buck some bigger place."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Try Gopher Prairie maybe?" suggested Mac, through the hiss and steam of the frying hamburger sandwich.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Rats. Too small."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Small? Why, there's darn near five thousand people there!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I know, but&mdash;I want to tackle some sure-nuff city. Like Duluth or New York."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But what'd you do?"
</poem>
</paragraph>
<paragraph keywords="garage, technology">
<poem>
"That's the devil of it. I don't know just what I do want to do. I could always land soft in a garage, but that's nothing new. Might hit Detroit, and learn the motor-factory end."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Aw, you're the limit, Milt. Always looking for something new."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"That's the way to get on. The rest of this town is afraid of new things. 'Member when I suggested we all chip in on a dynamo with a gas engine and have electric lights? The hicks almost died of nervousness."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yuh, that's true, but&mdash;&mdash; You stick here, Milt. You and me will just nachly run this burg."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'll say! Only&mdash;&mdash; Gosh, Mac, I would like to go to a real show, once. And find out how radio works. And see 'em put in a big suspension bridge!"
</poem>
</paragraph>
<paragraph keywords="mechanic, car model">
<poem>
Milt left the Old Home rather aimlessly. He told himself that he positively would not go back and help Ben Sittka get out the prof's car. So he went back and helped Ben get out the prof's car, and drove the same to the prof's. The prof, otherwise professor, otherwise mister, James Martin Jones, B.A., and Mrs. James Martin Jones welcomed him almost as noisily as had Mac. They begged him to come in. With Mr. Jones he discussed&mdash;no, ye Claires of Brooklyn Heights, this garage man and this threadbare young superintendent of a paintbare school, talking in a town that was only a comma on the line, did not discuss corn-growing, nor did they reckon to guess that by heck the constabule was carryin' on with the Widdy Perkins. They spoke of fish-culture, Elihu Root, the spiritualistic evidences of immortality, government ownership, self-starters for flivvers, and the stories of Irvin Cobb.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt went home earlier than he wanted to. Because Mr. Jones was the only man in town besides the priest who read books, because Mrs. Jones was the only woman who laughed about any topics other than children and family sickness, because he wanted to go to their house every night, Milt treasured his welcome as a sacred thing, and kept himself from calling on them more than once a week.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He stopped on his way to the garage to pet Emil Baumschweiger's large gray cat, publicly known as Rags, but to Milt and to the lady herself recognized as the unfortunate Countess Vere de Vere&mdash;perhaps the only person of noble ancestry and mysterious past in Milt's acquaintance. The Baumschweigers did not treat their animals well; Emil kicked the bay mare, and threw pitchforks at Vere de Vere. Milt saluted her and sympathized:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You have a punk time, don't you, countess? Like to beat it to Minneapolis with me?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The countess said that she did indeed have an extraordinarily punk time, and she sang to Milt the hymn of the little gods of the warm hearth. Then Milt's evening dissipations were over. Schoenstrom has movies only once a week. He sat in the office of his garage ruffling through a weekly digest of events. Milt read much, though not too easily. He had no desire to be a poet, an Indo-Iranian etymologist, a lecturer to women's clubs, or the secretary of state. But he did rouse to the marvels hinted in books and magazines; to large crowds, the mechanism of submarines, palm trees, gracious women.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He laid down the magazine. He stared at the wall. He thought about nothing. He seemed to be fumbling for something about which he could deliciously think if he could but grasp it. Without quite visualizing either wall or sea, he was yet recalling old dreams of a moonlit wall by a warm stirring southern sea. If there was a girl in the dream she was intangible as the scent of the night. Presently he was asleep, a not at all romantic figure, rather ludicrously tipped to one side in his office chair, his large solid shoes up on the desk.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He half woke, and filtered to what he called home&mdash;one room in the cottage of an oldish woman who had prejudices against the perilous night air. He was too sleepy to go through any toilet save pulling off his shoes, and achieving an unconvincing wash at the little stand, whose crackly varnish was marked with white rings from the toothbrush mug.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I feel about due to pull off some fool stunt. Wonder what it will be?" he complained, as he flopped on the bed.
</poem>
</paragraph>
<paragraph keywords="garage, car part, car model, maintenance">
<poem>
He was up at six, and at a quarter to seven was at work in the garage. He spent a large part of the morning in trying to prove to a customer that even a Teal car, best at the test, would not give perfect service if the customer persisted in forgetting to fill the oil-well, the grease-cups, and the battery.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
At three minutes after twelve Milt left the garage to go to dinner. The fog of the morning had turned to rain. McGolwey was not at the Old Home. Sometimes Mac got tired of serving meals, and for a day or two he took to a pocket flask, and among his former customers the cans of prepared meat at Rauskukle's became popular. Milt found him standing under the tin awning of the general store. He had a troubled hope of keeping Mac from too long a vacation with the pocket flask. But Mac was already red-eyed. He seemed only half to recognize Milt.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Swell day!" said Milt.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Y' bet."
</poem>
</paragraph>
<paragraph keywords="road condition, mud">
<poem>
"Road darn muddy."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I should worry. Yea, bo', I'm feelin' good!"
</poem>
</paragraph>
<paragraph keywords="car model, affect">
<poem>
At eleven minutes past twelve a Gomez-Dep roadster appeared down the road, stopped at the garage. To Milt it was as exciting as the appearance of a comet to a watching astronomer.
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
"What kind of a car do you call that, Milt?" asked a loafer.
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
"Gomez-Deperdussin."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Never heard of it. Looks too heavy."
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
This was sacrilege. Milt stormed, "Why, you poor floof, it's one of the best cars in the world. Imported from France. That looks like a special-made American body, though. Trouble with you fellows is, you're always scared of anything that's new. Too&mdash;heavy! Huh! Always wanted to see a Gomez&mdash;never have, except in pictures. And I believe that's a New York license. Let me at it!"
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
He forgot noon-hunger, and clumped through the rain to the garage. He saw a girl step from the car. He stopped, in the doorway of the Old Home, in uneasy shyness. He told himself he didn't "know just what it is about her&mdash;she isn't so darn unusually pretty and yet&mdash;gee&mdash;&mdash; Certainly isn't a girl to get fresh with. Let Ben take care of her. Like to talk to her, and yet I'd be afraid if I opened my mouth, I'd put my foot in it."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He was for the first time seeing a smart woman. This dark, slender, fine-nerved girl, in her plain, rough, closely-belted, gray suit, her small black Glengarry cocked on one side of her smooth hair, her little kid gloves, her veil, was as delicately adjusted as an aeroplane engine.
</poem>
</paragraph>
<paragraph keywords="car model, gender">
<poem>
Milt wanted to trumpet her exquisiteness to the world, so he growled to a man standing beside him, "Swell car. Nice-lookin' girl, kind of."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Kind of skinny, though. I like 'em with some meat on 'em," yawned the man.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
No, Milt did not strike him to earth. He insisted feebly, "Nice clothes she's got, though."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, not so muchamuch. I seen a woman come through here yesterday that was swell, though&mdash;had on a purple dress and white shoes and a hat big 's a bushel."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well, I don't know, I kind of like those simple things," apologized Milt.
</poem>
</paragraph>
<paragraph keywords="garage, car part, car model, mechanic">
<poem>
He crept toward the garage. The girl was inside. He inspected the slope-topped, patent-leather motoring trunk on the rack at the rear of the Gomez-Dep. He noticed a middle-aged man waiting in the car. "Must be her father. Probably&mdash;maybe she isn't married then." He could not get himself to shout at the man, as he usually did. He entered the garage office; from the inner door he peeped at the girl, who was talking to his assistant about changing an inner tube.
</poem>
</paragraph>
<paragraph keywords="car part, mechanic">
<poem>
That Ben Sittka whom an hour ago he had cajoled as a promising child he now admired for the sniffing calmness with which he was demanding, "Want a red or gray tube?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Really, I don't know. Which is the better?" The girl's voice was curiously clear.
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
Milt passed Claire Boltwood as though he did not see her; stood at the rear of the garage kicking at the tires of a car, his back to her. Over and over he was grumbling, "If I just knew one girl like that&mdash;&mdash; Like a picture. Like&mdash;like a silver vase on a blue cloth!"
</poem>
</paragraph>
<paragraph keywords="car part, mechanic">
<poem>
Ben Sittka did not talk to the girl while he inserted the tube in the spare casing. Only, in the triumphant moment when the parted ends of the steel rim snapped back together, he piped, "Going far?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes, rather. To Seattle."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt stared at the cobweb-grayed window. "Now I know what I was planning to do. I'm going to Seattle," he said.
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
The girl was gone at twenty-nine minutes after twelve. At twenty-nine and a half minutes after, Milt remarked to Ben Sittka, "I'm going to take a trip. Uh? Now don't ask questions. You take charge of the garage until you hear from me. Get somebody to help you. G'-by."
</poem>
</paragraph>
<paragraph keywords="car model, garage">
<poem>
He drove his Teal bug out of the garage. At thirty-two minutes after twelve he was in his room, packing his wicker suitcase by the method of throwing things in and stamping on the case till it closed. In it he had absolutely all of his toilet refinements and wardrobe except the important portion already in use. They consisted, according to faithful detailed report, of four extra pairs of thick yellow and white cotton socks; two shirts, five collars, five handkerchiefs; a pair of surprisingly vain dancing pumps; high tan laced boots; three suits of cheap cotton underclothes; his Sunday suit, which was dead black in color, and unimaginative in cut; four ties; a fagged toothbrush, a comb and hairbrush, a razor, a strop, shaving soap in a mug; a not very clean towel; and nothing else whatever.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
To this he added his entire library and private picture gallery, consisting of Ivanhoe, Ben-Hur, his father's copy of Byron, a wireless manual, and the 1916 edition of Motor Construction and Repairing: the art collection, one colored Sunday supplement picture of a princess lunching in a Provençe courtyard, and a half-tone of Colonel Paul Beck landing in an early military biplane. Under this last, in a pencil scrawl now blurred to grayness, Milt had once written, "This what Ill be aviator."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
What he was to wear was a piercing trouble. Till eleven minutes past twelve that day he had not cared. People accepted his overalls at anything except a dance, and at the dances he was the only one who wore pumps. But in his discovery of Claire Boltwood he had perceived that dressing is an art. Before he had packed, he had unhappily pawed at the prized black suit. It had become stupid. "Undertaker!" he growled.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
With a shrug which indicated that he had nothing else, he had exchanged his overalls for a tan flannel shirt, black bow tie, thick pigskin shoes, and the suit he had worn the evening before, his best suit of two years ago&mdash;baggy blue serge coat and trousers. He could not know it, but they were surprisingly graceful on his wiry, firm, white body.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
In his pockets were a roll of bills and an unexpectedly good gold watch. For warmth he had a winter ulster, an old-fashioned turtle-neck sweater, and a raincoat heavy as tarpaulin. He plunged into the raincoat, ran out, galloped to Rauskukle's store, bought the most vehement cap in the place&mdash;a plaid of cerise, orange, emerald green, ultramarine, and five other guaranteed fashionable colors. He stocked up with food for roadside camping.
</poem>
</paragraph>
<paragraph keywords="car part, car model, metaphor, equipment">
<poem>
In the humping tin-covered tail of the bug was a good deal of room, and this he filled with motor extras, a shotgun and shells, a pair of skates, and all his camping kit as used on his annual duck-hunting trip to Man Trap Lake.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'm a darned fool to take everything I own but&mdash;&mdash; Might be gone a whole month," he reflected.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He had only one possession left&mdash;a check book, concealed from the interested eye of his too maternal landlady by sticking it under the stair carpet. This he retrieved. It showed a balance of two hundred dollars. There was ten dollars in the cash register in the office, for Ben Sittka. The garage would, with the mortgage deducted, be worth nearly two thousand. This was his fortune.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He bolted into the kitchen and all in one shout he informed his landlady, "Called out of town, li'l trip, b'lieve I don't owe you an'thing, here's six dollars, two weeks' notice, dunno just when I be back."
</poem>
</paragraph>
<paragraph keywords="car model, driving, speed">
<poem>
Before she could issue a questionnaire he was out in the bug. He ran through town. At his friend McGolwey; now loose-lipped and wabbly, sitting in the rain on a pile of ties behind the railroad station, he yelled, "So long, Mac. Take care yourself, old hoss. Off on li'l trip."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He stopped in front of the "prof's," tooted till the heads of the Joneses appeared at the window, waved and shouted, "G'-by, folks. Goin' outa town."
</poem>
</paragraph>
<paragraph keywords="driving, speed, affect, car part">
<poem>
Then, while freedom and the distant Pacific seemed to rush at him over the hood, he whirled out of town. It was two minutes to one&mdash;forty-seven minutes since Claire Boltwood had entered Schoenstrom.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He stopped only once. His friend Lady Vere de Vere was at the edge of town, on a scientific exploring trip in the matter of ethnology and field mice. She hailed him, "Mrwr? Me mrwr!"
</poem>
</paragraph>
<paragraph keywords="animal, rain, car part">
<poem>
"You don't say so!" Milt answered in surprise. "Well, if I promised to take you, I'll keep my word." He vaulted out, tucked Vere de Vere into the seat, protecting her from the rain with the tarpaulin winter radiator-cover.
</poem>
</paragraph>
<paragraph keywords="car model, personification, road condition, accident, mud, speed">
<poem>
His rut-skipping car overtook the mud-walloping Gomez-Dep in an hour, and pulled it out of the mud.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Before Milt slept that night, in his camp three miles from Gopher Prairie, he went through religious rites.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Girl like her, she's darn particular about her looks. I'm a sloppy hound. Used to be snappier about my clothes when I was in high school. Getting lazy&mdash;too much like Mac. Think of me sleeping in my clothes last night!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Mrwr!" rebuked the cat.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You're dead right. Fierce is the word. Nev' will sleep in my duds again, puss. That is, when I have a reg'lar human bed. Course camping, different. But still&mdash;&mdash; Let's see all the funny things we can do to us."
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
He shaved&mdash;two complete shaves, from lather to towel. He brushed his hair. He sat down by a campfire sheltered between two rocks, and fought his nails, though they were discouragingly crammed with motor grease. Throughout this interesting but quite painful ceremony Milt kept up a conversation between himself as the World's Champion Dude, and his cat as Vallay. But when there was nothing more to do, and the fire was low, and Vere de Vere asleep in the sleeve of the winter ulster, his bumbling voice slackened; in something like agony he muttered:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But oh, what's the use? I can't ever be anything but a dub! Cleaning my nails, to make a hit with a girl that's got hands like hers! It's a long trail to Seattle, but it's a darn sight longer one to being&mdash;being&mdash;well, sophisticated. Oh! And incidentally, what the deuce am I going to do in Seattle if I do get there?"
</poem>
</paragraph>
</annotations><annotations>
===Chapter VI===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
THE LAND OF BILLOWING CLOUDS (66-73)
</paragraph>
<paragraph keywords="">
<poem>
Never a tawny-beached ocean has the sweetness of the prairie slew. Rippling and blue, with long grass up to its edge, a spot of dancing light set in the miles of rustling wheat, it retains even in July, on an afternoon of glare and brazen locusts, the freshness of a spring morning. A thousand slews, a hundred lakes bordered with rippling barley or tinkling bells of the flax, Claire passed. She had left the occasional groves of oak and poplar and silver birch, and come out on the treeless Great Plains.
</poem>
</paragraph>
<paragraph keywords="road condition, animal, twilight, lake, sound, plant, road side, train">
<poem>
She had learned to call the slews "pugholes," and to watch for ducks at twilight. She had learned that about the pugholes flutter choirs of crimson-winged blackbirds; that the ugly brown birds squatting on fence-rails were the divine-voiced meadow larks; that among the humble cowbird citizens of the pastures sometimes flaunted a scarlet tanager or an oriole; and that no rose garden has the quaint and hardy beauty of the Indian paint brushes and rag babies and orange milkweed in the prickly, burnt-over grass between roadside and railway line.
</poem>
</paragraph>
<paragraph keywords="garage, class">
<poem>
She had learned that what had seemed rudeness in garage men and hotel clerks was often a resentful reflection of her own Eastern attitude that she was necessarily superior to a race she had been trained to call "common people." If she spoke up frankly, they made her one of their own, and gave her companionable aid.
</poem>
</paragraph>
<paragraph keywords="sunshine, road condition, car part, scenery, skill, cloud, pleasure, mountain, pastoral">
<poem>
For two days of sunshine and drying mud she followed a road flung straight across flat wheatlands, then curving among low hills. Often there were no fences; she was so intimately in among the grain that the fenders of the car brushed wheat stalks, and she became no stranger, but a part of all this vast-horizoned land. She forgot that she was driving, as she let the car creep on, while she was transported by Armadas of clouds, prairie clouds, wisps of vapor like a ribbed beach, or mounts of cumulus swelling to gold-washed snowy peaks.
</poem>
</paragraph>
<paragraph keywords="passenger, pedestrian, road side">
<poem>
The friendliness of the bearing earth gave her a calm that took no heed of passing hours. Even her father, the abstracted man of affairs, nodded to dusty people along the road; to a jolly old man whose bulk rolled and shook in a tiny, rhythmically creaking buggy, to women in the small abrupt towns with their huge red elevators and their long, flat-roofed stores.
</poem>
</paragraph>
<paragraph keywords="affect, sunshine">
<poem>
Claire had discovered America, and she felt stronger, and all her days were colored with the sun.
</poem>
</paragraph>
<paragraph keywords="train, driving, affect, car">
<poem>
She had discovered, too, that she could adventure. No longer was she haunted by the apprehension that had whispered to her as she had left Minneapolis. She knew a thrill when she hailed&mdash;as though it were a passing ship&mdash;an Illinois car across whose dust-caked back was a banner "Chicago to the Yellowstone." She experienced a new sensation of common humanness when, on a railway paralleling the wagon road for miles, the engineer of a freight waved his hand to her, and tooted the whistle in greeting.
</poem>
</paragraph>
<paragraph keywords="affect">
<poem>
Her father was easily tired, but he drowsed through the early afternoons when a none-too-digestible small-town lunch was as lead within him. Despite the beauty of the land and the joy of pushing on, they both had things to endure.
</poem>
</paragraph>
<paragraph keywords="car part, engine, road condition, dust, taste, vision, anthropomorphism">
<poem>
After lunch, it was sometimes an agony to Claire to keep awake. Her eyes felt greasy from the food, or smarted with the sun-glare. In the still air, after the morning breeze had been burnt out, the heat from the engine was a torment about her feet; and if there was another car ahead, the trail of dust sifted into her throat. Unless there was traffic to keep her awake, she nodded at the wheel; she was merely a part of a machine that ran on without seeming to make any impression on the prairie's endlessness.
</poem>
</paragraph>
<paragraph keywords="slowness, road surface, driver, affect">
<poem>
Over and over there were the same manipulations: slow for down hill, careful of sand at the bottom, letting her out on a smooth stretch, waving to a lonely farmwife in her small, baked dooryard, slow to pass a hay-wagon, gas for up the next hill, and repeat the round all over again. But she was joyous till noon; and with mid-afternoon a new strength came which, as rose crept above the golden haze of dust, deepened into serene meditation.
</poem>
</paragraph>
<paragraph keywords="driver, affect, metaphor">
<poem>
And she was finding the one secret of long-distance driving&mdash;namely, driving; keeping on, thinking by fifty-mile units, not by the ten-mile stretches of Long Island runs; and not fretting over anything whatever. She seemed charmed; if she had a puncture&mdash;why, she put on the spare. If she ran out of gas&mdash;why, any passing driver would lend her a gallon. Nothing, it seemed, could halt her level flight across the giant land.
</poem>
</paragraph>
<paragraph keywords="map, navigation">
<poem>
She rarely lost her way. She was guided by the friendly trail signs&mdash;those big red R's and L's on fence post and telephone pole, magically telling the way from the Mississippi to the Pacific.
</poem>
</paragraph>
<paragraph keywords="passenger">
<poem>
Her father's occasional musing talk kept her from loneliness. He was a good touring companion. Motoring is not the best occasion for epigrams, satire, and the Good One You Got Off at the Lambs' Club last night. Such verbiage on motor trips invariably results in the mysterious finding of the corpse of a strange man, well dressed, hidden beside the road. Claire and her father mumbled, "Good farmhouse&mdash;brick," or "Nice view," and smiled, and were for miles as silent as the companionable sky.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She thought of the people she knew, especially of Jeff Saxton. But she could not clearly remember his lean earnest face. Between her and Jeff were sweeping sunny leagues. But she was not lonely. Certainly she was not lonely for a young man with a raincoat, a cat, and an interest in Japan.
</poem>
</paragraph>
<paragraph keywords="driving, affect, bridge, river, city">
<poem>
No singer after a first concert has felt more triumphant than Claire when she crossed her first state-line; rumbled over the bridge across the Red River into North Dakota. To see Dakota car licenses everywhere, instead of Minnesota, was like the sensation of street signs in a new language. And when she found a good hotel in Fargo and had a real bath, she felt that by her own efforts she had earned the right to enjoy it.
</poem>
</paragraph>
<paragraph keywords="affect, pioneer">
<poem>
Mr. Boltwood caught her enthusiasm. Dinner was a festival, and in iced tea the peaceful conquistadores drank the toast of the new Spanish Main; and afterward, arm in arm, went chattering to the movies.
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
In front of the Royal Palace, Pictures, 4 Great Acts Vaudeville 4, was browsing a small, beetle-like, tin-covered car.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Dad! Look! I'm sure&mdash;yes, of course, there's his suitcase&mdash;that's the car of that nice boy&mdash;don't you remember?&mdash;the one that pulled us out of the mud at&mdash;I don't remember the name of the place. Apparently he's keeping going. I remember; he's headed for Seattle, too. We'll look for him in the theater. Oh, the darling, there's his cat! What was the funny name he gave her&mdash;the Marchioness Montmorency or something?"
</poem>
</paragraph>
<paragraph keywords="animal, metaphor">
<poem>
Lady Vere de Vere, afraid of Fargo and movie crowds, but trusting in her itinerant castle, the bug, was curled in Milt Daggett's ulster, in the bottom of the car. She twinkled her whiskers at Claire, and purred to a stroking hand.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
With the excitement of one trying to find the address of a friend in a strange land Claire looked over the audience when the lights came on before the vaudeville. In the second row she saw Milt's stiffish, rope-colored mair&mdash;surprisingly smooth above an astoundingly clean new tan shirt of mercerized silk.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He laughed furiously at the dialogue between Pete-Rosenheim & Larose-Bettina, though it contained the cheese joke, the mother-in-law joke, and the joke about the wife rifling her husband's pockets.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Our young friend seems to have enviable youthful spirits," commented Mr. Boltwood.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Now, no superiority! He's probably never seen a real vaudeville show. Wouldn't it be fun to take him to the Winter Garden or the Follies for the first time!... Instead of being taken by Jeff Saxton, and having the humor, oh! so articulately explained!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The pictures were resumed; the film which, under ten or twelve different titles, Claire had already seen, even though Brooklyn Heights does not devote Saturday evening to the movies. The badman, the sheriff&mdash;an aged party with whiskers and boots&mdash;the holdup, the sad eyes of the sheriff's daughter&mdash;also an aged party, but with a sunbonnet and the most expensive rouge&mdash;the crook's reformation, and his violent adherence to law and order; this libel upon the portions of these United States lying west of longitude 101° Claire had seen too often. She dragged her father back to the hotel, sent him to bed, and entered her room&mdash;to find a telegram upon the bureau.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She had sent her friends a list of the places at which she would be likely to stop. The message was from Jeff Saxton, in Brooklyn. It brought to her mind the steady shine of his glasses&mdash;the most expensive glasses, with the very best curved lenses&mdash;as it demanded:
</poem>
</paragraph>
<paragraph keywords="train, road, risk">
<poem>
"Received letter about trip surprised anxious will tire you out fatigue prairie roads bad for your father mountain roads dangerous strongly advise go only part way then take train.      GEOFFREY."
</poem>
</paragraph>
<paragraph keywords="car model, car part, metaphor">
<poem>
She held the telegram, flipping her fingers against one end of it as she debated. She remembered how the wide world had flowed toward her over the hood of the Gomez all day. She wrote in answer:
</poem>
</paragraph>
<paragraph keywords="road condition, risk">
<poem>
"Awful perils of road, two punctures, split infinitive, eggs at lunch questionable, but struggle on."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Before she sent it she held council with her father. She sat on the foot of his bed and tried to sound dutiful. "I don't want to do anything that's bad for you, daddy. But isn't it taking your mind away from business?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Ye-es, I think it is. Anyway, we'll try it a few days more."
</poem>
</paragraph>
<paragraph keywords="affect, animal, risk, car model">
<poem>
"I fancy we can stand up under the strain and perils. I think we can persuade some of these big farmers to come to the rescue if we encounter any walruses or crocodiles among the wheat. And I have a feeling that if we ever get stuck, our friend of the Teal bug will help us."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Probably never see him again. He'll skip on ahead of us."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Of course. We haven't laid an eye on him, along the road. He must have gotten into Fargo long before we did. Now tomorrow I think&mdash;&mdash;"
</poem>
</paragraph>
</annotations><annotations>
===Chapter VII===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
THE GREAT AMERICAN FRYING PAN (74-84)
</paragraph>
<paragraph keywords="driver, skill, road">
<poem>
It was Claire's first bad day since the hole in the mud. She had started gallantly, scooting along the level road that flies straight west of Fargo. But at noon she encountered a restaurant which made eating seem an evil.
</poem>
</paragraph>
<paragraph keywords="traffic sign">
<poem>
That they might have fair fame among motorists the commercial club of Reaper had set at the edge of town a sign "Welcome to Reaper, a Live Town&mdash;Speed Limit 8 Miles perhr." Being interpreted, that sign meant that if you went much over twenty miles an hour on the main street, people might glance at you; and that the real welcome, the only impression of Reaper that tourists were likely to carry away, was the welcome in the one restaurant. It was called the Eats Garden. As Claire and her father entered, they were stifled by a belch of smoke from the frying pan in the kitchen. The room was blocked by a huge lunch counter; there was only one table, covered with oil cloth decorated with venerable spots of dried egg yolk.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The waiter-cook, whose apron was gravy-patterned, with a border and stomacher of plain gray dirt, grumbled, "Whadyuhwant?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire sufficiently recovered to pick out the type from the fly specks on the menu, and she ordered a small steak and coffee for her father; for herself tea, boiled eggs, toast.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Toast? We ain't got any toast!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well, can't you make it?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I suppose I could&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
When they came, the slices of toast were an inch thick, burnt on one side and raw on the other. The tea was bitter and the eggs watery. Her father reported that his steak was high-test rawhide, and his coffee&mdash;well, he wasn't sure just what substitute had been used for chicory, but he thought it was lukewarm quinine.
</poem>
</paragraph>
<paragraph keywords="class">
<poem>
Claire raged: "You know, this town really has aspirations. They're beginning to build such nice little bungalows, and there's a fine clean bank&mdash;&mdash; Then they permit this scoundrel to advertise the town among strangers, influential strangers, in motors, by serving food like this! I suppose they think that they arrest criminals here, yet this restaurant man is a thief, to charge real money for food like this&mdash;&mdash; Yes, and he's a murderer!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, come now, dolly!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes he is, literally. He must in his glorious career have given chronic indigestion to thousands of people&mdash;shortened their lives by years. That's wholesale murder. If I were the authorities here, I'd be indulgent to the people who only murder one or two people, but imprison this cook for life. Really! I mean it!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well, he probably does the best e&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"He does not! These eggs and this bread were perfectly good, before he did black magic over them. And did you see the contemptuous look he gave me when I was so eccentric as to order toast? Oh, Reaper, Reaper, you desire a modern town, yet I wonder if you know how many thousands of tourists go from coast to coast, cursing you? If I could only hang that restaurant man&mdash;and the others like him&mdash;in a rope of his own hempen griddle cakes! The Great American Frying Pan! I don't expect men building a new town to have time to read Hugh Walpole and James Branch Cabell, but I do expect them to afford a cook who can fry eggs!"
</poem>
</paragraph>
<paragraph keywords="affect, driving, engine, personification, dust">
<poem>
As she paid the check, Claire tried to think of some protest which would have any effect on the obese wits of the restaurant man. In face of his pink puffiness she gave it up. Her failure as a Citizeness Fixit sent her out of the place in a fury, carried her on in a dusty whirl till the engine spat, sounded tired and reflective, and said it guessed it wouldn't go any farther that day.
</poem>
</paragraph>
<paragraph keywords="maintenance, gasoline">
<poem>
Now that she had something to do, Claire became patient. "Run out of gas. Isn't it lucky I got that can for an extra gallon?"
</poem>
</paragraph>
<paragraph keywords="gasoline, engine, accident, car part, oil, driver">
<poem>
But there was plenty of gas. There was no discernible reason why the car should not go. She started the engine. It ran for half a minute and quit. All the plugs showed sparks. No wires were detached in the distributor. There was plenty of water, and the oil was not clogged. And that ended Claire's knowledge of the inside of a motor.
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
She stopped two motorists. The first was sure that there was dirt on the point of the needle valve, in the carburetor. While Claire shuddered lest he never get it back, he took out the needle valve, wiped it, put it back&mdash;and the engine was again started, and again, with great promptness, it stopped.
</poem>
</paragraph>
<paragraph keywords="car part, maintenance, gender">
<poem>
The second Good Samaritan knew that one of the wires in the distributor must be detached and, though she assured him that she had inspected them, he looked pityingly at her smart sports-suit, said, "Well, I'll just take a look," and removed the distributor cover. He also scratched his head, felt of the fuses under the cowl, scratched his cheek, poked a finger at the carburetor, rubbed his ear, said, "Well, uh&mdash;&mdash;" looked to see if there was water and gas, sighed, "Can't just seem to find out what's the trouble," shot at his own car, and escaped.
</poem>
</paragraph>
<paragraph keywords="affect, pastoral, metaphor, road">
<poem>
Claire had been highly grateful and laudatory to both of them&mdash;but she remained here, ten miles from nowhere. It was a beautiful place. Down a hill the wheat swam toward a village whose elevator was a glistening tower. Mud-hens gabbled in a slew, alfalfa shone with unearthly green, and bees went junketing toward a field of red clover. But she had the motorist's fever to go on. The road behind and in front was very long, very white&mdash;and very empty.
</poem>
</paragraph>
<paragraph keywords="class, driver, car part">
<poem>
Her father, out of much thought and a solid ignorance about all of motoring beyond the hiring of chauffeurs and the payment of bills,
suggested, "Uh, dolly, have you looked to see if these, uh&mdash;&mdash; Is the carburetor all right?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes, dear; I've looked at it three times, so far," she said, just a little too smoothly.
</poem>
</paragraph>
<paragraph keywords="car, dust, driver, speed">
<poem>
On the hill five miles to eastward, a line of dust, then a small car. As it approached, the driver must have sighted her and increased speed. He came up at thirty-five miles an hour.
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
"Now we'll get something done! Look! It's a bug&mdash;a flivver or a Teal or something. I believe it's the young man that got us out of the mud."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt Daggett stopped, casually greeted them: "Why, hello, Miss Boltwood. Thought you'd be way ahead of me some place!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Mrwr," said Vere de Vere. What this meant the historian does not know.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No; I've been taking it easy. Mr., Uh&mdash;I can't quite remember your name&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Milt Daggett."
</poem>
</paragraph>
<paragraph keywords="engine">
<poem>
"There's something mysterious the matter with my car. The engine will start, after it's left alone a while, but then it stalls. Do you suppose you could tell what it is?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I don't know. I'll see if I can find out."
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
"Then you probably will. The other two men knew everything. One of them was the inventor of wheels, and the other discovered skidding. So of course they couldn't help me."
</poem>
</paragraph>
<paragraph keywords="car part, maintenance">
<poem>
Milt added nothing to her frivolity, but his smile was friendly. He lifted the round rubber cap of the distributor. Then Claire's faith tumbled in the dust. Twice had the wires been tested. Milt tested them again. She was too tired of botching to tell him he was wasting time.
</poem>
</paragraph>
<paragraph keywords="oil">
<poem>
"Got an oil can?" he hesitated.
</poem>
</paragraph>
<paragraph keywords="maintenance, oil, personification">
<poem>
Through a tiny hole in the plate of the distributor he dripped two drops of oil&mdash;only two drops. "I guess maybe that's what it needed. You might try her now, and see how she runs," he said mildly.
</poem>
</paragraph>
<paragraph keywords="engine, pioneer">
<poem>
Dubiously Claire started the engine. It sang jubilantly, and it did not stop. Again was the road open to her. Again was the settlement over there, to which it would have taken her an hour to walk, only six minutes away.
</poem>
</paragraph>
<paragraph keywords="engine, car part, oil, maintenance">
<poem>
She stopped the engine, beamed at him&mdash;there in the dust, on the quiet hilltop. He said as apologetically as though he had been at fault, "Distributor got dry. Might give it a little oil about once in six months."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"We are so grateful to you! Twice now you've saved our lives."
</poem>
</paragraph>
<paragraph keywords="driver">
<poem>
"Oh, I guess you'd have gone on living! And if drivers can't help each other, who can?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"That's a good start toward world-fellowship, I suppose. I wish we could do&mdash;&mdash; Return your lunch or&mdash;&mdash; Mr. Daggett! Do you read books? I mean&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes I do, when I run across them."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Mayn't I gi&mdash;lend you these two that I happen to have along? I've finished them, and so has father, I think."
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
From the folds of the strapped-down top she pulled out Compton Mackenzie's ''Youth's Encounter'', and Vachel Lindsay's ''Congo''. With a curious faint excitement she watched him turn the leaves. His blunt fingers flapped through them as though he was used to books. As he looked at ''Congo'', he exclaimed, "Poetry! That's fine! Like it, but I don't hardly ever run across it. I&mdash;&mdash; Say&mdash;&mdash; I'm terribly obliged!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
His clear face lifted, sun-brown and young and adoring. She had not often seen men look at her thus. Certainly Jeff Saxton's painless
worship did not turn him into the likeness of a knight among banners. Yet the good Geoffrey loved her, while to Milt Daggett she could be nothing more than a strange young woman in a car with a New York license. If her tiny gift could so please him, how poor he must be. "He probably lives on some barren farm," she thought, "or he's a penniless mechanic hoping for a good job in Seattle. How white his forehead is!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
But aloud she was saying, "I hope you're enjoying your trip."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh yes. I like it fine. You having a good time? Well&mdash;&mdash; Well, thanks for the books."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She was off before him. Presently she exclaimed to Mr. Boltwood: "You know&mdash;just occurs to me&mdash;it's rather curious that our young friend should be so coincidental as to come along just when we needed him."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, he just happened to, I suppose," hemmed her father.
</poem>
</paragraph>
<paragraph keywords="animal, roadkill, car part">
<poem>
"I'm not so sure," she meditated, while she absently watched another member of the Poultry Suicide Club rush out of a safe ditch, prepare to take leave for immortality, change her fowlish mind, flutter up over the hood of the car, and come down squawking her indignities to the barnyard. "I'm not so sure about his happening&mdash;&mdash; No. I wonder if he could possibly&mdash;&mdash; Oh no. I hope not. Flattering, but&mdash;&mdash; You don't suppose he could be deliberately following us?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Nonsense! He's a perfectly decent young chap."
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
"I know. Of course. He probably works hard in a garage, and is terribly nice to his mother and sisters at home. I mean&mdash;&mdash; I wouldn't want the dear lamb to be a devoted knight, though. Too thankless a job."
</poem>
</paragraph>
<paragraph keywords="road, car model">
<poem>
She slowed the car down to fifteen an hour. For the first time she began to watch the road behind her. In a few minutes a moving spot showed in the dust three miles back. Oh, naturally; he would still be behind her. Only&mdash;&mdash; If she stopped, just to look at the scenery, he would go on ahead of her. She stopped for a moment&mdash;for a time too brief to indicate that anything had gone wrong with her car. Staring back she saw that the bug stopped also, and she fancied that Milt was out standing beside it, peering with his palm over his eyes&mdash;a spy, unnatural and disturbing in the wide peace.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She drove on a mile and halted again; again halted her attendant. He was keeping a consistent two to four miles behind, she estimated.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"This won't do at all," she worried. "Flattering, but somehow&mdash;&mdash; Whatever sort of a cocoon-wrapped hussy I am, I don't collect scalps. I won't have young men serving me&mdash;graft on them&mdash;get amusement out of their struggles. Besides&mdash;suppose he became just a little more friendly, each time he came up, all the way from here to Seattle?... Fresh.... No, it won't do."
</poem>
</paragraph>
<paragraph keywords="road side">
<poem>
She ran the car to the side of the road.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"More trouble?" groaned her father.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No. Just want to see scenery."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But&mdash;&mdash; There's a good deal of scenery on all sides, without stopping, seems to me!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes, but&mdash;&mdash;" She looked back. Milt had come into sight; had paused to take observations. Her father caught it:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I see. Pardon me. Our squire still following? Let him go on ahead? Wise lass."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes. I think perhaps it's better to avoid complications."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Of course." Mr. Boltwood's manner did not merely avoid Milt; it abolished him.
</poem>
</paragraph>
<paragraph keywords="driving, sound, car part">
<poem>
She saw Milt, after five minutes of stationary watching, start forward. He came dustily rattling up with a hail of "Distributor on strike again?" so cheerful that it hurt her to dismiss him. But she had managed a household. She was able to say suavely:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No, everything is fine. I'm sure it will be, now. I'm afraid we are holding you back. You mustn't worry about us."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, that's all right," breezily. "Something might go wrong. Say, is this poetry book&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No, I'm sure nothing will go wrong now. You mustn't feel responsible for us. But, uh, you understand we're very grateful for what you have done and, uh, perhaps we shall see each other in Seattle?" She made it brightly interrogatory.
</poem>
</paragraph>
<paragraph keywords="car part, car model, haptic">
<poem>
"Oh, I see." His hands gripped the wheel. His cheeks had been too ruddily tinted by the Dakota sun to show a blush, but his teeth caught his lower lip. He had no starter on his bug; he had in his embarrassment to get out and crank. He did it quietly, not looking at her. She could see that his hand trembled on the crank. When he did glance at her, as he drove off, it was apologetically, miserably. His foot was shaking on the clutch pedal.
</poem>
</paragraph>
<paragraph keywords="dust">
<poem>
The dust behind his car concealed him. For twenty miles she was silent, save when she burst out to her father, "I do hope you're enjoying the trip. It's so easy to make people unhappy. I wonder&mdash;&mdash; No. Had to be done."
</poem>
</paragraph>
</annotations><annotations>
===Chapter VIII===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
THE DISCOVERY OF CANNED SHRIMPS AND HESPERIDES (85-100)
</paragraph>
<paragraph keywords="garage">
<poem>
On the morning when Milt Daggett had awakened to sunshine in the woods north of Gopher Prairie, he had discovered the golden age. As mile on mile he jogged over new hills, without having to worry about getting back to his garage in time to repair somebody's car, he realized that for the past two years he had forced himself to find contentment in building up a business that had no future.
</poem>
</paragraph>
<paragraph keywords="driving, pleasure, car part, metaphor, car model, driver">
<poem>
Now he laughed and whooped; he drove with one foot inelegantly and enchantingly up on the edge of the cowl; he made Lady Vere de Vere bow to astounded farmers; he went to the movies every evening&mdash;twice, in Fargo; and when the chariot of the young prince swept to the brow of a hill, he murmured, not in the manner of a bug-driver but with a stinging awe, "All that big country! Ours to see, puss! We'll settle down some day and be solid citizens and raise families and wheeze when we walk, but&mdash;&mdash; All those hills to sail over and&mdash;&mdash; Come on! Lez sail!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt attended the motion pictures every evening, and he saw them in a new way. As recently as one week before he had preferred those earnest depictions in which hard-working, moral actors shoot one another, or ride the most uncomfortable horses up mountainsides. But now, with a mental apology to that propagandist of lowbrowism, the absent Mac, he chose the films in which the leading men wore evening clothes, and no one ever did anything without being assisted by a "man." Aside from the pictures Milt's best tutors were traveling men. Though he measured every cent, and for his campfire dinners bought modest chuck steaks, he had at least one meal a day at a hotel, to watch the traveling men.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
To Claire, traveling men were merely commercial persons in hard-boiled suits. She identified them with the writing-up of order-slips on long littered writing-tables, and with hotels that reduced the delicate arts of dining and sleeping to gray greasiness. But Milt knew traveling men. He knew that not only were they the missionaries of business, supplementing the taking of orders by telling merchants how to build up trade, how to trim windows and treat customers like human beings; but also that they, as much as the local ministers and doctors and teachers and newspapermen, were the agents in spreading knowledge and justice. It was they who showed the young men how to have their hair cut&mdash;and to wash behind the ears and shave daily; they who encouraged villagers to rise from scandal and gossip to a perception of the Great World, of politics and sports, and some measure of art and science.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Claire, and indeed her father and Mr. Jeff Saxton as well, had vaguely concluded that because drummers were always to be seen in soggy hotels and badly connecting trains and the headachy waiting-rooms of stations, they must like these places. Milt knew that the drummers were martyrs; that for months of a trip, all the while thinking of the children back home, they suffered from landlords and train schedules; that they were Claire's best allies in fighting the Great American Frying Pan; that they knew good things, and fought against the laziness and impositions of people who "kept hotel" because they had failed as farmers; and that when they did find a landlord who was cordial and efficient, they went forth mightily advertising that glorious man. The traveling men, he knew, were pioneers in spats.
</poem>
</paragraph>
<paragraph keywords="car model, class">
<poem>
Hence it was to the traveling men, not to supercilious tourists in limousines, that Milt turned for suggestions as to how to perform the miracle of changing from an ambitious boy into what Claire would recognize as a charming man. He had not met enough traveling men at Schoenstrom. They scooped up what little business there was, and escaped from the Leipzig House to spend the night at St. Cloud or Sauk Centre.
</poem>
</paragraph>
<paragraph keywords="road side, car model">
<poem>
In the larger towns in Minnesota and Dakota, after evening movies, before slipping out to his roadside camp Milt inserted himself into a circle of traveling men in large leather chairs, and ventured, "Saw a Gomez-Dep with a New York license down the line today."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh. You driving through?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes. Going to Seattle."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
That distinguished Milt from the ordinary young-men-loafers, and he was admitted as one of the assembly of men who traveled and saw things and wondered about the ways of men. It was good talk he heard; too much of hotels, and too many tight banal little phrases suggesting the solution of all economic complexities by hanging "agitators," but with this, an exciting accumulation of impressions of Vancouver and San Diego, Florida and K. C.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"That's a wonderful work farm they have at Duluth," said one, and the next, "speaking of that, I was in Chicago last week, and I saw a play&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt had, in his two years of high school in St. Cloud, and in his boyhood under the genial but abstracted eye of the Old Doctor, learned that it was not well thought of to use the knife as a hod and to plaster mashed potatoes upon it, as was the custom in Mac's Old Home Lunch at Schoenstrom. But the arts of courteously approaching oysters, salad, and peas were rather unfamiliar to him. Now he studied forks as he had once studied carburetors, and he gave spiritual devotion to the nice eating of a canned-shrimp cocktail&mdash;a lost legion of shrimps, now two thousand miles and two years away from their ocean home.
</poem>
</paragraph>
<paragraph keywords="car part, class">
<poem>
He peeped with equal earnestness at the socks and the shirts of the traveling men. Socks had been to him not an article of faith but a detail of economy. His attitude to socks had lacked in reverence and technique. He had not perceived that socks may be as sound a symbol of culture as the 'cello or even demountable rims. He had been able to think with respect of ties and damp piqué collars secured by gold safety-pins; and to the belted fawn overcoat that the St. Klopstock banker's son had brought back from St. Paul, he had given jealous attention. But now he graduated into differential socks.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
By his campfire, sighing to the rather somnolent Vere de Vere, he scornfully yanked his extra pairs of thick, white-streaked, yellow cotton socks from the wicker suitcase, and uttered anathema:
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
"Begone, ye unworthy and punk-looking raiment. I know ye! Ye werst a bargain and two pairs for two bits. But even as Adolph Zolzac and an agent for flivver accessories are ye become in my eyes, ye generation of vipers, ye clumsy, bag-footed, wrinkle-sided gunny-sacking ye!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Next day, in the woods, a happy hobo found that the manna-bringing ravens had left him four pairs of good socks.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Five quite expensive pairs of silk and lisle socks Milt purchased&mdash;all that the general merchant at Jeppe had in stock. What they lost in suitability to touring and to private laundering at creeks, they gained as symbols. Milt felt less shut out from the life of leisure. Now, in Seattle, say, he could go into a good hotel with less fear of the clerks.
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
He added attractive outing shirts, ties neither too blackly dull nor too flashily crimson, and a vicious nail-brush which simply tore out the motor grease that had grown into the lines of his hands. Also he added a book.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The book was a rhetoric. Milt knew perfectly that there was an impertinence called grammar, but it had never annoyed him much. He knew that many persons preferred "They were" to "They was," and were nervous in the presence of "ain't." One teacher in St. Cloud had buzzed frightfully about these minutiæ. But Milt discovered that grammar was only the beginning of woes. He learned that there were such mental mortgages as figures of speech and the choice of synonyms. He had always known, but he had never passionately felt that the invariable use of "hell," "doggone," and "You bet!" left certain subtleties unexpressed. Now he was finding subtleties which he had to express.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
As joyously adventurous as going on day after day was his experimentation in voicing his new observations. He gave far more eagerness to it than Claire Boltwood had. Gustily intoning to Vere de Vere, who was the perfect audience, inasmuch as she never had anything to say but "Mrwr," and didn't mind being interrupted in that, he clamored, "The prairies are the sea. In the distance they are kind of silvery&mdash;no&mdash;they are dim silver; and way off on the skyline are the Islands of the&mdash;of the&mdash;&mdash; Now what the devil was them, were those, islands in the mythology book in high school? Of the&mdash;Blessed? Great snakes' boots, you're an ignorant cat, Vere! Hesperyds? No! Hesperides! Yea, bo'! Now that man in the hotel: 'May I trouble you for the train guide? Thanks so much!' But how much is so much?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
As Claire's days were set free by her consciousness of sun and brown earth, so Milt's odyssey was only the more valorous in his endeavor to criticize life. He saw that Mac's lunch room had not been an altogether satisfactory home; that Mac's habit of saying to dissatisfied customers, "If you don't like it, get out," had lacked something of courtesy. Staring at towns along the way, Milt saw that houses were not merely large and comfortable, or small and stingy; but that there was an interesting thing he remembered hearing his teachers call "good taste."
</poem>
</paragraph>
<paragraph keywords="garage, passenger">
<poem>
He was not the preoccupied Milt of the garage but a gay-eyed gallant, the evening when he gave a lift to the school-teacher and drove her from the district school among the wild roses and the corn to her home in the next town. She was a neat, tripping, trim-sided school-teacher of nineteen or twenty.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You're going out to Seattle? My! That's a wonderful trip. Don't you get tired?" she adored.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, no. And I'm seeing things. I used to think everything worth while was right near my own town."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You're so wise to go places. Most of the boys I know don't think there is any world beyond Jimtown and Fargo."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She glowed at him. Milt was saying to himself, "Am I a fool? I probably could make this girl fall in love with me. And she's better than I am; so darn neat and clean and gentle. We'd be happy. She's a nice comfy fire, and here I go like a boob, chasing after a lone, cold star like Miss Boltwood, and probably I'll fall into all the slews from hell to breakfast on the way. But&mdash;&mdash; I'd get sleepy by a comfy fire."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Are you thinking hard? You're frowning so," ventured the
school-teacher.
</poem>
</paragraph>
<paragraph keywords="car part, engine, sound, pioneer">
<poem>
"Didn't mean to. 'Scuse!" he laughed. One hand off the steering wheel, he took her hand&mdash;a fresh, cool, virginal hand, snuggling into his, suddenly stirring him. He wanted to hold it tighter. The lamenting historian of love's pilgrimage must set down the fact that the pilgrim for at least a second forgot the divine tread of the goddess Claire, and made rapid calculation that he could, in a pinch, drive from Schoenstrom to the teacher's town in two days and a night; that therefore courtship, and this sweet white hand resting in his, were not impossible. Milt himself did not know what it was that made him lay down the hand and say, so softly that he was but half audible through the rattle of the engine:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Isn't this a slick, mean to say glorious evening? Sky rose and then that funny lavender. And that new moon&mdash;&mdash; Makes me think of&mdash;the girl I'm in love with."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You're engaged?" wistfully.
</poem>
</paragraph>
<paragraph keywords="garage">
<poem>
"Not exactly but&mdash;&mdash; Say, did you study rhetoric in Normal School? I have a rhetoric that's got all kind of poetic extracts, you know, and quotations and everything, from the big writers, Stevenson and all. Always been so practical, making a garage pay, never thought much about how I said things as long as I could say 'No!' and say it quick. 'Cept maybe when I was talking to the prof there. But it's great sport to see how musical you can make a thing sound. Words. Like Shenandoah. Gol-lee! Isn't that a wonderful word? Makes you see old white mansion, and mocking birds&mdash;&mdash; Wonder if a fellow could be a big engineer, you know, build bridges and so on, and still talk about, oh, beautiful things? What d' you think, girlie?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I'm sure you could!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Her admiration, the proximity of her fragrant slightness, was pleasant in the dusk, but he did not press her hand again, even when she whispered, "Good night, and thank you&mdash;oh, thank you."
</poem>
</paragraph>
<paragraph keywords="speed, road, metaphor">
<poem>
If Milt had been driving at the rate at which he usually made his skipjack carom over the roads about Schoenstrom, he would by now have been through Dakota, into Montana. But he was deliberately holding down the speed. When he had been tempted by a smooth stretch to go too breathlessly, he halted, teased Vere de Vere, climbed out and, sitting on a hilltop, his hands about his knees, drenched his soul with the vision of amber distances.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He tried so to time his progress that he might always be from three to five miles behind Claire&mdash;distant enough to be unnoticed, near enough to help in case of need. For behind poetic expression and the use of forks was the fact that his purpose in life was to know Claire.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
When he was caught, when Claire informed him that he "mustn't worry about her"; when, slowly, he understood that she wasn't being neighborly and interested in his making time, he wanted to escape, never to see her again.
</poem>
</paragraph>
<paragraph keywords="driver, car model">
<poem>
For thirty miles his cheeks were fiery. He, most considerate of roadmen, crowded a woman in a flivver, passed a laboring car on an upgrade with such a burst that the uneasy driver bumped off into a ditch. He hadn't really seen them. Only mechanically had he got past them. He was muttering:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"She thought I was trying to butt in! Stung again! Like a small boy in love with teacher. And I thought I was so wise! Cussed out Mac&mdash;blamed Mac&mdash;no, damn all the fine words&mdash;cussed out Mac for being the village rumhound. Boozing is twice as sensible as me. See a girl, nice dress&mdash;start for Seattle! Two thousand miles away! Of course she bawled me out. She was dead right. Boob! Yahoo! Goat!"
</poem>
</paragraph>
<paragraph keywords="road side">
<poem>
He caught up Vere de Vere, rubbed her fur against his cheek while he mourned, "Oh, puss, you got to be nice to me. I thought I'd do big things. And then the alarm clock went off. I'm back in Schoenstrom. For keeps, I guess. I didn't know I had feelings that could get hurt like this. Thought I had a rhinoceros hide. But&mdash;&mdash; Oh, it isn't just feeling ashamed over being a fool. It's that&mdash;&mdash; Won't ever see her again. Not once. Way I saw her through the window, at that hotel, in that blue silky dress&mdash;that funny long line of buttons, and her throat. Never have dinner&mdash;lunch&mdash;with her by the road&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="garage, maintenance">
<poem>
In the reaction of anger he demanded of Vere de Vere, "What the deuce do I care? If she's chump enough to chase away a crack garage man that's gone batty and wants to work for nothing, let her go on and hit some crook garage and get stuck for an entire overhauling. What do I care? Had nice trip; that's all I wanted. Never did intend to go clear to Seattle, anyway. Go on to Butte, then back home. No more fussing about fool table-manners and books, and I certainly will cut out tagging behind her! No, sir! Nev-er again!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
It was somewhat inconsistent to add, "There's a bully place&mdash;sneak in and let her get past me again. But she won't catch me following next time!"
</poem>
</paragraph>
<paragraph keywords="parking, plant">
<poem>
While he tried to keep up his virtuous anger, he was steering into an abandoned farmyard, parking the car behind cottonwoods and neglected tall currant bushes which would conceal it from the road.
</poem>
</paragraph>
<paragraph keywords="affect, sound, plant, visibility">
<poem>
The windows of the deserted house stared at him; a splintered screen door banged in every breeze. Lichens leered from the cracks of the porch. The yard was filled with a litter of cottonwood twigs, and over the flower garden hulked ragged weeds. In the rank grass about the slimy green lip of the well, crickets piped derisively. The barn-door was open. Stray kernels of wheat had sprouted between the spokes of a rusty binder-wheel. A rat slipped across the edge of the shattered manger. As dusk came on, gray things seemed to slither past the upper windows of the house, and somewhere, under the roof, there was a moaning. Milt was sure that it was the wind in a knothole. He told himself that he was absolutely sure about it. And every time it came he stroked Vere de Vere carefully, and once, when the moaning ended in the slamming of the screen door, he said, "Jiminy!"
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
This boy of the unghostly cylinders and tangible magnetos had never seen a haunted house. To toil of the harvest field and machine shop and to trudging the sun-beaten road he was accustomed, but he had never crouched watching the slinking spirits of old hopes and broken aspirations; feeble phantoms of the first eager bridegroom who had come to this place, and the mortgage-crushed, rust-wheat-ruined man who had left it. He wanted to leap into the bug and go on. Yet the haunt of murmurous memories dignified his unhappiness. In the soft, tree-dimmed dooryard among dry, blazing plains it seemed indecent to go on growling "Gee," and "Can you beat it?" It was a young poet, a poet rhymeless and inarticulate, who huddled behind the shield of untrimmed currant bushes, and thought of the girl he would never see again.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He was hungry, but he did not eat. He was cramped, but he did not move. He picked up the books she had given him. He was quickened by the powdery beauty of ''Youth's Encounter''; by the vision of laughter and dancing steps beneath a streaky gas-glow in the London fog; of youth not "roughhousing" and wanting to "be a sport," yet in frail beauty and faded crimson banners finding such exaltation as Schoenstrom had never known. But every page suggested Claire, and he tucked the book away.
</poem>
</paragraph>
<paragraph keywords="religion, pioneer, sound">
<poem>
In Vachel Lindsay's ''Congo'', in a poem called "The Santa Fe Trail," he found his own modern pilgrimage from another point of view. Here was the poet, disturbed by the honking hustle of passing cars. But Milt belonged to the honking and the hustle, and it was not the soul of the grass that he read in the poem, but his own sun-flickering flight:
</poem>
</paragraph>
<paragraph keywords="intertext, car, speed, road, fog, sound, animal, scenery, mountain, personification">
<poem>
    Swiftly the brazen car comes on.
    It burns in the East as the sunrise burns.
    I see great flashes where the far trail turns.
    Butting through the delicate mists of the morning,
    It comes like lightning, goes past roaring,
    It will hail all the windmills, taunting, ringing,
    On through the ranges the prairie-dog tills&mdash;
    Scooting past the cattle on the thousand hills.
    Ho for the tear-horn, scare-horn, dare-horn,
    Ho for the gay-horn, bark-horn, bay-horn.
</poem>
</paragraph>
<paragraph keywords="car model, driver">
<poem>
Milt did not reflect that if the poet had watched the Teal bug go by, he would not have recorded a scare-horn, a dare-horn, or anything mightier than a yip-horn. Milt saw himself a cross-continent racer, with the envious poet, left behind as a dot on the hill, celebrating his passing.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Lord!" he cried. "I didn't know there were books like these! Thought poetry was all like Longfellow and Byron. Old boys. Europe. And rhymed bellyachin' about hard luck. But these books&mdash;they're me." Very carefully: "No; they're I! And she gave 'em to me! I will see her again! But she won't know it. Now be sensible, son! What do you expect? Oh&mdash;nothing. I'll just go on, and sneak in one more glimpse of her to take back with me where I belong."
</poem>
</paragraph>
<paragraph keywords="car part, accident, road side, maintenance">
<poem>
Half an hour after Claire had innocently passed his ambush, he began to follow her. But not for days was he careless. If he saw her on the horizon he paused until she was out of sight. That he might not fail her in need, he bought a ridiculously expensive pair of field glasses, and watched her when she stopped by the road. Once, when both her right rear tire and the spare were punctured before she could make a town, Milt from afar saw her patch a tube, pump up the tire in the dust. He ached to go to her aid&mdash;though it cannot be said that hand-pumping was his favorite July afternoon sport.
</poem>
</paragraph>
<paragraph keywords="car model, garage">
<poem>
Lest he encounter her in the streets, he always camped to the eastward of the town at which she spent the night. After dusk, when she was likely to end the day's drive in the first sizable place, he hid his bug in an alley and, like a spy after the papers, sneaked into each garage to see if her car was there.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He would stroll in, look about vacuously, and pipe to the suspicious night attendant, "Seen a traveling man named Smith?" Usually the garage man snarled, "No, I ain't seen nobody named Smith. An'thing else I can do for you?" But once he was so unlucky as to find the long-missing Mr. Smith!
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Mr. Smith was surprised and insistent. Milt had to do some quick lying. During that interview the cement floor felt very hard under his fidgeting feet, and he thought he heard the garage man in the office telephoning, "Don't think he knows Smith at all. I got a hunch he's that auto thief that was through here last summer."
</poem>
</paragraph>
<paragraph keywords="twilight, driving, night, risk, metaphor, car model, car part, vision">
<poem>
When Claire did not stop in the first town she reached after twilight, but drove on by dark, he had to do some perilous galloping to catch up. The lights of a Teal are excellent for adornment, but they have no relation to illumination. They are dependent upon a magneto which is dependent only upon faith.
</poem>
</paragraph>
<paragraph keywords="night, car model">
<poem>
Once, skittering along by dark, he realized that the halted car which he had just passed was the Gomez. He thought he heard a shout behind him, but in a panic he kept going.
</poem>
</paragraph>
<paragraph keywords="sound, car">
<poem>
To the burring motor he groaned, "Now I probably never will see her again. Except that she thinks I'm such a pest that I dassn't let her know I'm in the same state, I sure am one successful lover. As a Prince Charming I win the Vanderbilt Cup. I'm going ahead backwards so fast I'll probably drop off into the Atlantic over the next hill!"
</poem>
</paragraph>
</annotations><annotations>
===Chapter IX===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
THE MAN WITH AGATE EYES (101-111)
</paragraph>
<paragraph keywords="scenery, river, West">
<poem>
When her car had crossed the Missouri River on the swing-ferry between Bismarck and Mandan, Claire had passed from Middle West to Far West. She came out on an upland of virgin prairie, so treeless and houseless, so divinely dipping, so rough of grass, that she could imagine buffaloes still roving. In a hollow a real prairie schooner was camped, and the wandering homestead-seekers were cooking dinner beside it. From a quilt on the hay in the wagon a baby peeped, and Claire's heart leaped.
</poem>
</paragraph>
<paragraph keywords="mountain">
<poem>
Beyond was her first butte, its sharp-cut sides glittering yellow, and she fancied that on it the Sioux scout still sat sentinel, erect on his pony, the feather bonnet down his back.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Now she seemed to breathe deeper, see farther. Again she came from unbroken prairie into wheat country and large towns.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Her impression of the new land was not merely of sun-glaring breadth. Sometimes, on a cloudy day, the wash of wheatlands was as brown and lowering and mysterious as an English moor in the mist. It dwarfed the far-off houses by its giant enchantment; its brooding reaches changed her attitude of brisk, gas-driven efficiency into a melancholy that was full of hints of old dark beauty.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Even when the sun came out, and the land was brazenly optimistic, she saw more than just prosperity. In a new home, house and barn and windmill square-cornered and prosaic, plumped down in a field with wheat coming up to the unporticoed door, a habitation unshadowed, unsheltered, unsoftened, she found a frank cleanness, as though the inhabitants looked squarely out at life, unafraid. She felt that the keen winds ought to blow away from such a prairie-fronting post of civilization all mildew and cowardice, all the mummy dust of ancient fears.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
These were not peasants, these farmers. Nor, she learned, were they the "hicks" of humor. She could never again encounter without fiery
resentment the Broadway peddler's faith that farmers invariably say "Waal, by heck." For she had spent an hour talking to one Dakota farmer, genial-eyed, quiet of speech. He had explained the relation of alfalfa to soil-chemistry; had spoken of his daughter, who taught economics in a state university; and asked Mr. Boltwood how turbines were hitched up on liners.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
In fact, Claire learned that there may be an almost tolerable state of existence without gardenias or the news about the latest Parisian imagists.
</poem>
</paragraph>
<paragraph keywords="road, animal">
<poem>
She dropped suddenly from the vast, smooth-swelling miles of wheatland into the tortured marvels of the Bad Lands, and the road twisted in the shadow of flying buttresses and the terraced tombs of maharajas. While she tried to pick her way through a herd of wild, arroyo-bred cattle, she forgot her maneuvering as she was startled by the stabbing scarlet of a column of rock marking the place where for months deep beds of lignite had burned.
</poem>
</paragraph>
<paragraph keywords="hitchhiker, car part">
<poem>
Claire had often given lifts to tramping harvesters and even hoboes along the road; had enjoyed the sight of their duffle-bags stuck up between the sleek fenders and the hood, and their talk about people and crops along the road, as they hung on the running-board. In the country of long hillslopes and sentinel buttes between the Dakota Bad Lands and Miles City she stopped to shout to a man whose plodding heavy back looked fagged, "Want a ride?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Sure! You bet!"
</poem>
</paragraph>
<paragraph keywords="hitchhiker, car part, road side">
<poem>
Usually her guests stepped on the right-hand running-board, beside Mr. Boltwood, and this man was far over on the right side of the road. But, while she waited, he sauntered in front of the car, round to her side, mounted beside her. Before the car had started, she was sorry to have invited him. He looked her over grinningly, almost contemptuously. His unabashed eyes were as bright and hard as agates. Below them, his nose was twisted a little, his mouth bent insolently up at one corner, and his square long chin bristled.
</poem>
</paragraph>
<paragraph keywords="driver, gender">
<poem>
Usually, too, her passengers waited for her to start the conversation, and talked at Mr. Boltwood rather than directly to her. But the bristly man spat at her as the car started, "Going far?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Ye-es, some distance."
</poem>
</paragraph>
<paragraph keywords="car">
<poem>
"Expensive car?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"'Fraid of getting held up?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I hadn't thought about it."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Pack a cannon, don't you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I don't think I quite understand."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Cannon! Gun! Revolver! Got a revolver, of course?"
</poem>
</paragraph>
<paragraph keywords="road, mountain, risk">
<poem>
"W-why, no." She spoke uncomfortably. She was aware that his twinkling eyes were on her throat. His look made her feel unclean. She tried to think of some question which would lead the conversation to the less exclamatory subject of crops. They were on a curving shelf road beside a shallow valley. The road was one side of a horseshoe ten miles long. The unprotected edge of it dropped sharply to fields forty or fifty feet below.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Prosperous-looking wheat down there," she said.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No. Not a bit!" His look seemed to add, "And you know it&mdash;unless you're a fool!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Well, I didn't&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Make Glendive tonight?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"At least that far."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Say, lady, how's the chance for borrowin' a couple of dollars? I was workin' for a Finnski back here a ways, and he did me dirt&mdash;holdin' out my wages on me till the end of the month."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why, uh&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
It was Claire, not the man, who was embarrassed.
</poem>
</paragraph>
<paragraph keywords="car, class">
<poem>
He was snickering, "Come on, don't be a tightwad. Swell car&mdash;poor man with no eats, not even a two-bits flop for tonight. Could yuh loosen up and slip me just a couple bones?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Mr. Boltwood intervened. He looked as uncomfortable as Claire. "We'll see. It's rather against my principles to give money to an able-bodied man like you, even though it is a pleasure to give you a ride&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Sure! Don't cost you one red cent!"
</poem>
</paragraph>
<paragraph keywords="class">
<poem>
"&mdash;and if I could help you get a job, though of course&mdash;&mdash; Being a
stranger out here&mdash;&mdash; Seems strange to me, though," Mr. Boltwood
struggled on, "that a strong fellow like you should be utterly destitute, when I see all these farmers able to have cars&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Their guest instantly abandoned his attitude of supplication for one of boasting: "Destitute? Who the hell said I was destitute, heh?" He was snarling across Claire at Mr. Boltwood. His wet face was five inches from hers. She drew her head as far back as she could. She was sure that the man completely appreciated her distaste, for his eyes popped with amusement before he roared on:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I got plenty of money! Just 'cause I'm hoofin' it&mdash;&mdash; I don't want no charity from nobody! I could buy out half these Honyockers! I don't need none of no man's money!" He was efficiently working himself into a rage. "Who you calling destitute? All I wanted was an advance till pay day! Got a check coming. You high-tone, kid-glove Eastern towerists want to watch out who you go calling destitute. I bet I make a lot more money than a lot of your four-flushin' friends!"
</poem>
</paragraph>
<paragraph keywords="risk, hitchhiker">
<poem>
Claire wondered if she couldn't stop the car now, and tell him to get off. But&mdash;that snapping eye was too vicious. Before he got off he would say things&mdash;scarring, vile things, that would never heal in her brain. Her father was murmuring, "Let's drop him," but she softly lied, "No. His impertinence amuses me."
</poem>
</paragraph>
<paragraph keywords="driving, affect">
<poem>
She drove on, and prayed that he would of himself leave his uncharitable hosts at the next town.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The man was storming&mdash;with a very meek ending: "I'm tellin' you! I can make money anywhere! I'm a crack machinist.... Give me two-bits for a meal, anyway."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Mr. Boltwood reached in his change pocket. He had no quarter. He pulled out a plump bill-fold. Without looking at the man, Claire could vision his eyes glistening and his chops dripping as he stared at the hoard. Mr. Boltwood handed him a dollar bill. "There, take that, and let's change the subject," said Mr. Boltwood testily.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"All right, boss. Say, you haven't got a cartwheel instead of this wrapping paper, have you? I like to feel my money in my pocket."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No, sir, I have not!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"All right, boss. No bad feelin's!"
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
Then he ignored Mr. Boltwood. His eyes focused on Claire's face. To steady himself on the running-board he had placed his left hand on the side of the car, his right on the back of the seat. That right hand slid behind her. She could feel its warmth on her back.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She burst out, flaring, "Kindly do not touch me!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Gee, did I touch you, girlie? Why, that's a shame!" he drawled, his cracked broad lips turning up in a grin.
</poem>
</paragraph>
<paragraph keywords="road, car part">
<poem>
An instant later, as they skipped round a bend of the long, high-hung shelf road, he pretended to sway dangerously on the running-board, and deliberately laid his filthy hand on her shoulder. Before she could say anything he yelped in mock-regret, "Love o' Mike! 'Scuse me, lady. I almost fell off."
</poem>
</paragraph>
<paragraph keywords="driver, gender">
<poem>
Quietly, seriously, Claire said, "No, that wasn't accidental. If you touch me again, I'll stop the car and ask you to walk."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Better do it now, dolly!" snapped Mr. Boltwood.
</poem>
</paragraph>
<paragraph keywords="car part, metaphor, risk, hitchhiker, driver">
<poem>
The man hooked his left arm about the side-post of the open window-shield. It was a strong arm, a firm grip. He seized her left wrist with his free hand. Though all the while his eyes grotesquely kept their amused sparkle, and beside them writhed laughter-wrinkles, he shouted hoarsely, "You'll stop hell!" His hand slid from her wrist to the steering wheel. "I can drive this boat's well as you can. You make one move to stop, and I steer her over&mdash;&mdash; Blooie! Down the bank!"
</poem>
</paragraph>
<paragraph keywords="car part, road side, risk">
<poem>
He did twist the front wheels dangerously near to the outer edge of the shelf road. Mr. Boltwood gazed at the hand on the wheel. With a quick breath Claire looked at the side of the road. If the car ran off, it would shoot down forty feet ... turning over and over.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Y-you wouldn't dare, because you'd g-go, too!" she panted.
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
"Well, dearuh, you just try any monkey business and you'll find out how much I'll gggggggo-too! I'll start you down the joy-slope and jump off, savvy? Take your foot off that clutch."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
She obeyed.
</poem>
</paragraph>
<paragraph keywords="car part, class">
<poem>
"Pretty lil feet, ain't they, cutie! Shoes cost about twelve bucks, I reckon. While a better man than you or old moldy-face there has to hit the pike in three-dollar brogans. Sit down, yuh fool!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
This last to Mr. Boltwood, who had stood up, swaying with the car, and struck at him. With a huge arm the man swept Mr. Boltwood back into the seat, but without a word to her father, he continued to Claire:
</poem>
</paragraph>
<paragraph keywords="car part, risk, car, driver, skill">
<poem>
"And keep your hand where it belongs. Don't go trying to touch that switch. Aw, be sensible! What would you do if the car did stop? I could blackjack you both before this swell-elegant vehickle lost momentum, savvy? I don't want to pay out my good money to a lawyer on a charge of&mdash;murder. Get me? Better take it easy and not worry." His hand was constantly on the wheel. He had driven cars before. He was steering as much as she. "When I get you up the road a piece I'm going to drive all the cute lil boys and girls up a side trail, and take all of papa's gosh-what-a-wad in the cunnin' potet-book, and I guess we'll kiss lil daughter, and drive on, a-wavin' our hand politely, and let you suckers walk to the next burg."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You wouldn't dare! You wouldn't dare!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Dare? Huh! Don't make the driver laugh!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I'll get help!"
</poem>
</paragraph>
<paragraph keywords="car, accident, risk">
<poem>
"Yep. Sure. Fact, there's a car comin' toward us. 'Bout a mile away I'd make it, wouldn't you? Well, dollface, if you make one peep&mdash;over the bank you go, both of you dead as a couplin'-pin. Smeared all over those rocks. Get me? And me&mdash;I'll be sorry the regrettable accident was so naughty and went and happened&mdash;and I just got off in time meself. And I'll pinch papa's poke while I'm helping get out the bodies!"
</poem>
</paragraph>
<paragraph keywords="car model, skill">
<poem>
Till now she hadn't believed it. But she dared not glance at the approaching car. It was their interesting guest who steered the Gomez past the other; and he ran rather too near the edge of the road ... so that she looked over, down.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Beaming, he went on, "I'd pull the rough stuff right here, instead of wastin' my time as a cap'n of industry by taking you up to see the scenery in that daisy little gully off the road; but the whole world can see us along here&mdash;the hicks in the valley and anybody that happens to sneak along in a car behind us. Shame the way this road curves&mdash;see too far along it. Fact, you're giving me a lot of trouble. But you'll give me a kiss, won't you, Gwendolyn?"
</poem>
</paragraph>
<paragraph keywords="driver, risk, gender, car part">
<poem>
He bent down, chuckling. She could feel his bristly chin touch her cheek. She sprang up, struck at him. He raised his hand from the wheel. For a second the car ran without control. He jabbed her back into the seat with his elbow. "Don't try any more monkey-shines, if you know what's good for you," he said, quite peacefully, as he resumed steering.
</poem>
</paragraph>
<paragraph keywords="sound, onomatopoeia">
<poem>
She was in a haze, conscious only of her father's hand fondling hers. She heard a quick pit-pit-pit-pit behind them. Car going to pass? She'd have to let it go by. She'd concentrate on finding something she could&mdash;&mdash;
</poem>
</paragraph>
<paragraph keywords="car model">
<poem>
Then, "Hello, folks. Having a picnic? Who's your little friend in the rompers?" sang out a voice beside them. It was Milt Daggett&mdash;the Milt who must be scores of miles ahead. His bug had caught up with them, was running even with them on the broad road.
</poem>
</paragraph>
</annotations><annotations>
===Chapter X===
<paragraph keywords="">
<poem>
</poem>
</paragraph>
<paragraph keywords="">
THE CURIOUS INCIDENT OF THE HILLSIDE ROAD (112-118)
</paragraph>
<paragraph keywords="car part, risk">
<poem>
So unexpectedly, so genially, that Claire wondered if he realized what was happening, Milt chuckled to the tough on the running-board, as the two cars ran side by side, "Bound for some place, brother?"
</poem>
</paragraph>
<paragraph keywords="car part, risk, speed, hitchhiker">
<poem>
The unwelcome guest looked puzzled. For the first time his china eyes ceased twinkling; and he answered dubiously: "Just gettin' a lift." He sped up the car with the hand-throttle. Milt accelerated equally.
</poem>
</paragraph>
<paragraph keywords="affect, risk">
<poem>
Claire roused; wanted to shout. She was palsied afraid that Milt would leave them. The last time she had seen him, she had suggested that leaving them would be a favor.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Her guest growled at her&mdash;the words coming through a slit at the corner of his rowdy mouth, "Sit still, or I'll run you over."
</poem>
</paragraph>
<paragraph keywords="car">
<poem>
Milt innocently babbled on, "Better come ride with me, bo'. More room in this-here handsome coupelet."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Then was the rough relieved in his uneasy tender little heart, and his eyes flickered again as he shouted back, not looking at Milt, "Thanks, bub, I'll stick by me friends."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh no; can't lose pleasure of your company. I like your looks. You're a bloomin' little island way off on the dim silver skyline." Claire knitted her brows. She had not seen Milt's rhetoric. "You're an island of Hesperyds or Hesperides. Accent on the bezuzus. Oh, yes, moondream, I think you better come. Haven't decided"&mdash;Milt's tone was bland&mdash;"whether to kill you or just have you pinched. Miss Boltwood! Switch off your power!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"If she does," the tough shouted, "I'll run 'em off the bank."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No, you won't, sweetheart, 'cause why? 'Cause what'll I do to you
afterwards?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"You won't do nothin', Jack, 'cause I'd gouge your eyes out."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why, lovesoul, d' you suppose I'd be talking up as brash as this to a bid, stwong man like oo if I didn't have a gun handy?"
</poem>
</paragraph>
<paragraph keywords="metaphor">
<poem>
"Yuh, I guess so, lil sunbeam. And before you could shoot, I'd crowd your tin liz into the bank, and jam right into it! I may get killed, but you won't even be a grease-spot!"
</poem>
</paragraph>
<paragraph keywords="car model, driver">
<poem>
He was turning the Gomez from its straight course, forcing Milt's bug toward the high bank of earth which walled in the road on the left.
</poem>
</paragraph>
<paragraph keywords="car model, risk">
<poem>
While Claire was very sick with fear, then more sick with contempt, Milt squealed, "You win!" And he had dropped back. The Gomez was going on alone.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
There was only one thing more for Claire&mdash;to jump. And that meant death.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
The tough was storming, "Your friend's a crack shot&mdash;with his mouth!"
</poem>
</paragraph>
<paragraph keywords="sound, onomatopoeia, car model, speed, car part, skill, risk">
<poem>
The thin pit-pit-pit was coming again. She looked back. She saw Milt's bug snap forward so fast that on a bump its light wheels were in the air. She saw Milt standing on the right side of the bug holding the wheel with one hand, and the other hand&mdash;firm, grim, broad-knuckled hand&mdash;outstretched toward the tough, then snatching at his collar.
</poem>
</paragraph>
<paragraph keywords="car part">
<poem>
The tough's grip was torn from the steering wheel. He was yanked from the running-board. He crunched down on the road.
</poem>
</paragraph>
<paragraph keywords="car part, affect, speed">
<poem>
She seized the wheel. She drove on at sixty miles an hour. She had gone a good mile before she got control of her fear and halted. She saw Milt turn his little car as though it were a prancing bronco. It seemed to paw the air with its front wheels. He shot back, pursuing the late guest. The man ran bobbing along the road. At this distance he was no longer formidable, but a comic, jerking, rabbity figure, humping himself over the back track.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
As the bug whirled down on him, the tough was to be seen throwing up his hands, leaping from the high bank.
</poem>
</paragraph>
<paragraph keywords="slowness, engine">
<poem>
Milt turned again and came toward them, but slowly; and after he had drawn up even and switched off the engine, he snatched off his violent plaid cap and looked apologetic.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Sorry I had to kid him along. I was afraid he really would drive you off the bank. He was a bad actor. And he was right; he could have licked me. Thought maybe I could jolly him into getting off, and have him pinched, next town."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But you had a gun&mdash;a revolver&mdash;didn't you, lad?" panted Mr. Boltwood.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Um, wellllll&mdash;&mdash; I've got a shotgun. It wouldn't take me more 'n five or ten minutes to dig it out, and put it together. And there's some shells. They may be all right. Haven't looked at 'em since last fall. They didn't get so awful damp then."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But suppose he'd had a revolver himself?" wailed Claire.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Gee, you know, I thought he probably did have one. I was scared blue. I had a wrench to throw at him though," confided Milt.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"How did you know we needed you?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Why back there, couple miles behind you, maybe I saw your father get up and try to wrestle him, so I suspected there was kind of a disagreement. Say, Miss Boltwood, you know when you spoke to me&mdash;way back there&mdash;I hadn't meant to butt in. Honest. I thought maybe as we were going&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I know!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"&mdash;the same way, you wouldn't mind my trailing, if I didn't sit in too often; and I thought maybe I could help you if&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, I know! I'm so ashamed! So bitterly ashamed! I just meant&mdash;&mdash; Will you forgive me? You were so good, taking care of us&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Oh, sure, that's all right!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"I fancy you do know how grateful father and I are that you were behind us, this time! Wasn't it a lucky accident that we'd slipped past you some place!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes," dryly, "quite an accident. Well, I'll skip on ahead again. May run into you again before we hit Seattle. Going to take the run through Yellowstone Park?"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Yes, but&mdash;&mdash;" began Claire. Her father interrupted:
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Uh, Mr., uh&mdash;Daggett, was it?&mdash;I wonder if you won't stay a little closer to us hereafter? I was getting rather a good change out of the trip, but I'm afraid that now&mdash;&mdash; If it wouldn't be an insult, I'd beg you to consider staying with us for a consideration, uh, you know, remuneration, and you could&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Thanks, uh, thank you, sir, but I wouldn't like to do it. You see, it's kind of my vacation. If I've done anything I'm tickled&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"But perhaps," Mr. Boltwood ardently begged the young man recently so abysmally unimportant, "perhaps you would consent to being my guest, when you cared to&mdash;say at hotels in the Park."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"'Fraid I couldn't. I'm kind of a lone wolf."
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Please! Pretty please!" besought Claire. Her smile was appealing, her eyes on his.
</poem>
</paragraph>
<paragraph keywords="">
<poem>
Milt bit his knuckles. He looked weak. But he persisted, "No, you'll get over this scrap with our friend. By the way, I'll put the deputy onto him, in the next town. He'll never get out of the county. When you forget him&mdash;&mdash; Oh no, you can go on fine. You're a good steady driver, and the road's perfectly safe&mdash;if you give people the once-over before you pick 'em up. Picking up badmen is no more dangerous here than it would be in New York. Fact, there's lot more hold-ups in any city than in the wildest country. I don't think you showed such awfully good taste in asking Terrible Tim, the two-gun man, right into the parlor. Gee, please don't do it again! Please!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"No," meekly. "I was an idiot. I'll be good, next time. But won't you stay somewhere near us?"
</poem>
</paragraph>
<paragraph keywords="car">
<poem>
"I'd like to, but I got to chase on. Don't want to wear out the welcome on the doormat, and I'm due in Seattle, and&mdash;&mdash; Say, Miss Boltwood." He swung out of the bug, cranked up, climbed back, went awkwardly on, "I read those books you gave me. They're slick&mdash;mean to say, interesting. Where that young fellow in ''Youth's Encounter'' wanted to be a bishop and a soldier and everything&mdash;&mdash; Just like me, except Schoenstrom is different, from London, some ways! I always wanted to be a brakie, and then a yeggman. But I wasn't bright enough for either. I just became a garage man. And I&mdash;&mdash; Some day I'm going to stop using slang. But it'll take an operation!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
He was streaking down the road, and Claire was sobbing, "Oh, the lamb, the darling thing! Fretting about his slang, when he wasn't afraid in that horrible nightmare. If we could just do something for him!"
</poem>
</paragraph>
<paragraph keywords="">
<poem>
"Don't you worry about him, dolly. He's a very energetic chap. And&mdash;&mdash; Uh&mdash;&mdash; Mightn't we drive on a little farther, perhaps? I confess that the thought of our recent guest still in this vicinity&mdash;&mdash;"
</poem>
</paragraph>
<paragraph keywords="metaphor">
<poem>
"Yes, and&mdash;&mdash; Oh, I'm shameless. If Mohammed Milton won't stay with our car mountain, we're going to tag after him."
</poem>
</paragraph>
<paragraph keywords="car model, road">
<poem>
But when she reached the next hill, with its far shining outlook, there was no Milt and no Teal bug on the road ahead.
</poem>
</paragraph>


</annotations>
</annotations>

Latest revision as of 12:43, 24 February 2026

Bibliographic Information
Author Lewis, Sinclair
Genre Fiction
Journal or Book Free Air
Publisher -
Year of Publication 1919
Pages 3-118
Additional information -

Chapter I


MISS BOLTWOOD OF BROOKLYN IS LOST IN THE MUD (3-9)


When the windshield was closed it became so filmed with rain that Claire fancied she was piloting a drowned car in dim spaces under the sea. When it was open, drops jabbed into her eyes and chilled her cheeks. She was excited and thoroughly miserable. She realized that these Minnesota country roads had no respect for her polite experience on Long Island parkways. She felt like a woman, not like a driver.

carcar metaphoraffectcar partdrivingdriving skillroaddriverrain


But the Gomez-Dep roadster had seventy horsepower, and sang songs. Since she had left Minneapolis nothing had passed her. Back yonder a truck had tried to crowd her, and she had dropped into a ditch, climbed a bank, returned to the road, and after that the truck was not. Now she was regarding a view more splendid than mountains above a garden by the sea--a stretch of good road. To her passenger, her father, Claire chanted:

carengineroadroad condition soundmountain


"Heavenly! There's some gravel. We can make time. We'll hustle on to the next town and get dry."

gravelroad condition


"Yes. But don't mind me. You're doing very well," her father sighed.


Instantly, the dismay of it rushing at her, she saw the end of the patch of gravel. The road ahead was a wet black smear, criss-crossed with ruts. The car shot into a morass of prairie gumbo--which is mud mixed with tar, fly-paper, fish glue, and well-chewed, chocolate-covered caramels. When cattle get into gumbo, the farmers send for the stump-dynamite and try blasting.

gravelcarmudroadcaranimal


It was her first really bad stretch of road. She was frightened. Then she was too appallingly busy to be frightened, or to be Miss Claire Boltwood, or to comfort her uneasy father. She had to drive. Her frail graceful arms put into it a vicious vigor that was genius.

driverroadaffectsafetydriving skillroad condition


When the wheels struck the slime, they slid, they wallowed. The car skidded. It was terrifyingly out of control. It began majestically to turn toward the ditch. She fought the steering wheel as though she were shadow-boxing, but the car kept contemptuously staggering till it was sideways, straight across the road. Somehow, it was back again, eating into a rut, going ahead. She didn't know how she had done it, but she had got it back. She longed to take time to retrace her own cleverness in steering. She didn't. She kept going.

car partdrivingdriving skillpersonificationrisk


The car backfired, slowed. She yanked the gear from third into first. She sped up. The motor ran like a terrified pounding heart, while the car crept on by inches through filthy mud that stretched ahead of her without relief.

carcar partspeedenginemudroad surfacedriving


She was battling to hold the car in the principal rut. She snatched the windshield open, and concentrated on that left rut. She felt that she was keeping the wheel from climbing those high sides of the rut, those six-inch walls of mud, sparkling with tiny grits. Her mind snarled at her arms, "Let the ruts do the steering. You're just fighting against them." It worked. Once she let the wheels alone they comfortably followed the furrows, and for three seconds she had that delightful belief of every motorist after every mishap, "Now that this particular disagreeableness is over, I'll never, never have any trouble again!"

carcar metaphorcar partroad conditionaffect


But suppose the engine overheated, ran out of water? Anxiety twanged at her nerves. And the deep distinctive ruts were changing to a complex pattern, like the rails in a city switchyard. She picked out the track of the one motor car that had been through here recently. It was marked with the swastika tread of the rear tires. That track was her friend; she knew and loved the driver of a car she had never seen in her life.

affectdriverenginecar partroaddriver


She was very tired. She wondered if she might not stop for a moment. Then she came to an upslope. The car faltered; felt indecisive beneath her. She jabbed down the accelerator. Her hands pushed at the steering wheel as though she were pushing the car. The engine picked up, sulkily kept going. To the eye, there was merely a rise in the rolling ground, but to her anxiety it was a mountain up which she--not the engine, but herself--pulled this bulky mass, till she had reached the top, and was safe again--for a second. Still there was no visible end of the mud.

drivingcarcar partengineroad surfacemudmountain


In alarm she thought, "How long does it last? I can't keep this up. I--Oh!"


The guiding tread of the previous car was suddenly lost in a mass of heaving, bubble-scattered mud, like a batter of black dough. She fairly picked up the car, and flung it into that welter, through it, and back into the reappearing swastika-marked trail.

cardrivingmudroad condition


Her father spoke: "You're biting your lips. They'll bleed, if you don't look out. Better stop and rest.


"Can't! No bottom to this mud. Once stop and lose momentum--stuck for keeps!"

drivingmud


She had ten more minutes of it before she reached a combination of bridge and culvert, with a plank platform above a big tile drain. With this solid plank bottom, she could stop. Silence came roaring down as she turned the switch. The bubbling water in the radiator steamed about the cap. Claire was conscious of tautness of the cords of her neck in front; of a pain at the base of her brain. Her father glanced at her curiously. "I must be a wreck. I'm sure my hair is frightful," she thought, but forgot it as she looked at him. His face was unusually pale. In the tumult of activity he had been betrayed into letting the old despondent look blur his eyes and sag his mouth. "Must get on," she determined.

car partinfrastructuremetaphor


Claire was dainty of habit. She detested untwisted hair, ripped gloves, muddy shoes. Hesitant as a cat by a puddle, she stepped down on the bridge. Even on these planks, the mud was three inches thick. It squidged about her low, spatted shoes. "Eeh!" she squeaked.

infrastructuremud


She tiptoed to the tool-box and took out a folding canvas bucket. She edged down to the trickling stream below. She was miserably conscious of a pastoral scene all gone to mildew--cows beneath willows by the creek, milkweeds dripping, dried mullein weed stalks no longer dry. The bank of the stream was so slippery that she shot down two feet, and nearly went sprawling. Her knee did touch the bank, and the skirt of her gray sports-suit showed a smear of yellow earth.

equipmentriverruralscenery


In less than two miles the racing motor had used up so much water that she had to make four trips to the creek before she had filled the radiator. When she had climbed back on the running-board she glared down at spats and shoes turned into gray lumps. She was not tearful. She was angry.

car partengineaffect


"Idiot! Ought to have put on my rubbers. Well--too late now," she observed, as she started the engine.

engine


She again followed the swastika tread. To avoid a hole in the road ahead, the unknown driver had swung over to the side of the road, and taken to the intensely black earth of the edge of an unfenced cornfield. Flashing at Claire came the sight of a deep, water-filled hole, scattered straw and brush, débris of a battlefield, which made her gaspingly realize that her swastikaed leader had been stuck and--

road conditionagriculturedrivingroadrural


And instantly her own car was stuck.

car


She had had to put the car at that hole. It dropped, far down, and it stayed down. The engine stalled. She started it, but the back wheels spun merrily round and round, without traction. She did not make one inch. When she again killed the blatting motor, she let it stay dead. She peered at her father.

accidentcarenginemetaphorpersonification


He was not a father, just now, but a passenger trying not to irritate the driver. He smiled in a waxy way, and said, "Hard luck! Well, you did the best you could. The other hole, there in the road, would have been just as bad. You're a fine driver, dolly."

driverpassengerroad conditiondriving skill


Her smile was warm and real. "No. I'm a fool. You told me to put on chains. I didn't. I deserve it."

equipment


"Well, anyway, most men would be cussing. You acquire merit by not beating me. I believe that's done, in moments like this. If you'd like, I'll get out and crawl around in the mud, and play turtle for you."


"No. I'm quite all right. I did feel frightfully strong-minded as long as there was any use of it. It kept me going. But now I might just as well be cheerful, because we're stuck, and we're probably going to stay stuck for the rest of this care-free summer day."

equipment


The weariness of the long strain caught her, all at once. She slipped forward, sat huddled, her knees crossed under the edge of the steering wheel, her hands falling beside her, one of them making a faint brushing sound as it slid down the upholstery. Her eyes closed; as her head drooped farther, she fancied she could hear the vertebrae click in her tense neck.

car partsound


Her father was silent, a misty figure in a lap-robe. The rain streaked the mica lights in the side-curtains. A distant train whistled desolately across the sodden fields. The inside of the car smelled musty. The quiet was like a blanket over the ears. Claire was in a hazy drowse. She felt that she could never drive again.

carsmellaffectdrivetrain


Chapter II


CLAIRE ESCAPES FROM RESPECTABILITY (10-20)


Claire Boltwood lived on the Heights, Brooklyn. Persons from New York and other parts of the Middlewest have been known to believe that Brooklyn is somehow humorous. In newspaper jokes and vaudeville it is so presented that people who are willing to take their philosophy from those sources believe that the leading citizens of Brooklyn are all deacons, undertakers, and obstetricians. The fact is that North Washington Square, at its reddest and whitest and fanlightedest, Gramercy Park at its most ivied, are not so aristocratic as the section of Brooklyn called the Heights. Here preached Henry Ward Beecher. Here, in mansions like mausoleums, on the ridge above docks where the good ships came sailing in from Sourabaya and Singapore, ruled the lords of a thousand sails. And still is it a place of wealth too solid to emulate the nimble self-advertising of Fifth Avenue. Here dwell the fifth-generation possessors of blocks of foundries and shipyards. Here, in a big brick house of much dignity, much ugliness, and much conservatory, lived Claire Boltwood, with her widower father.


Henry B. Boltwood was vice-president of a firm dealing in railway supplies. He was neither wealthy nor at all poor. Every summer, despite Claire's delicate hints, they took the same cottage on the Jersey Coast, and Mr. Boltwood came down for Sunday. Claire had gone to a good school out of Philadelphia, on the Main Line. She was used to gracious leisure, attractive uselessness, nut-center chocolates, and a certain wonder as to why she was alive.

train


She wanted to travel, but her father could not get away. He consistently spent his days in overworking, and his evenings in wishing he hadn't overworked. He was attractive, fresh, pink-cheeked, white-mustached, and nerve-twitching with years of detail.


Claire's ambition had once been babies and a solid husband, but as various young males of the species appeared before her, sang their mating songs and preened their newly dry-cleaned plumage, she found that the trouble with solid young men was that they were solid. Though she liked to dance, the "dancing men" bored her. And she did not understand the district's quota of intellectuals very well; she was good at listening to symphony concerts, but she never had much luck in discussing the cleverness of the wood winds in taking up the main motif. It is history that she refused a master of arts with an old violin, a good taste in ties, and an income of eight thousand.


The only man who disturbed her was Geoffrey Saxton, known throughout the interwoven sets of Brooklyn Heights as "Jeff." Jeff Saxton was thirty-nine to Claire's twenty-three. He was clean and busy; he had no signs of vice or humor. Especially for Jeff must have been invented the symbolic morning coat, the unwrinkable gray trousers, and the moral rimless spectacles. He was a graduate of a nice college, and he had a nice tenor and a nice family and nice hands and he was nicely successful in New York copper dealing. When he was asked questions by people who were impertinent, clever, or poor, Jeff looked them over coldly before he answered, and often they felt so uncomfortable that he didn't have to answer.


The boys of Claire's own age, not long out of Yale and Princeton, doing well in business and jumping for their evening clothes daily at six-thirty, light o' loves and admirers of athletic heroes, these lads Claire found pleasant, but hard to tell apart. She didn't have to tell Jeff Saxton apart. He did his own telling. Jeff called—not too often. He sang—not too sentimentally. He took her father and herself to the theater—not too lavishly. He told Claire—in a voice not too serious—that she was his helmed Athena, his rose of all the world. He informed her of his substantial position—not too obviously. And he was so everlastingly, firmly, quietly, politely, immovably always there.


She watched the hulk of marriage drifting down on her frail speed-boat of aspiration, and steered in desperate circles.


Then her father got the nervous prostration he had richly earned. The doctor ordered rest. Claire took him in charge. He didn't want to travel. Certainly he didn't want the shore or the Adirondacks. As there was a branch of his company in Minneapolis, she lured him that far away.


Being rootedly of Brooklyn Heights, Claire didn't know much about the West. She thought that Milwaukee was the capital of Minnesota. She was not so uninformed as some of her friends, however. She had heard that in Dakota wheat was to be viewed in vast tracts—maybe a hundred acres.


Mr. Boltwood could not be coaxed to play with the people to whom his Minneapolis representative introduced him. He was overworking again, and perfectly happy. He was hoping to find something wrong with the branch house. Claire tried to tempt him out to the lakes. She failed. His nerve-fuse burnt out the second time, with much fireworks.


Claire had often managed her circle of girls, but it had never occurred to her to manage her executive father save by indirect and pretty teasing. Now, in conspiracy with the doctor, she bullied her father. He saw gray death waiting as alternative, and he was meek. He agreed to everything. He consented to drive with her across two thousand miles of plains and mountains to Seattle, to drop in for a call on their cousins, the Eugene Gilsons.

drivingscenery


Back East they had a chauffeur and two cars—the limousine, and the Gomez-Deperdussin roadster, Claire's beloved. It would, she believed, be more of a change from everything that might whisper to Mr. Boltwood of the control of men, not to take a chauffeur. Her father never drove, but she could, she insisted. His easy agreeing was pathetic. He watched her with spaniel eyes. They had the Gomez roadster shipped to them from New York.

drivercar modelpleasuregender


On a July morning, they started out of Minneapolis in a mist, and as it has been hinted, they stopped sixty miles northward, in a rain, also in much gumbo. Apparently their nearest approach to the Pacific Ocean would be this oceanically moist edge of a cornfield, between Schoenstrom and Gopher Prairie, Minnesota.

fograinroad conditionmud


 *****


Claire roused from her damp doze and sighed, "Well, I must get busy and get the car out of this."

caraffectaccident


"Don't you think you'd better get somebody to help us?"


"But get who?"


"Whom!"


"No! It's just 'who,' when you're in the mud. No. One of the good things about an adventure like this is that I must do things for myself. I've always had people to do things for me. Maids and nice teachers and you, old darling! I suppose it's made me soft. Soft—I would like a soft davenport and a novel and a pound of almond-brittle, and get all sick, and not feel so beastly virile as I do just now. But——"

mudaccidentaffect


She turned up the collar of her gray tweed coat, painfully climbed out—the muscles of her back racking—and examined the state of the rear wheels. They were buried to the axle; in front of them the mud bulked in solid, shiny blackness. She took out her jack and chains. It was too late. There was no room to get the jack under the axle. She remembered from the narratives of motoring friends that brush in mud gave a firmer surface for the wheels to climb upon.

car partroad conditionmudequipmentaccident


She also remembered how jolly and agreeably heroic the accounts of their mishaps had sounded—a week after they were over.


She waded down the road toward an old wood-lot. At first she tried to keep dry, but she gave it up, and there was pleasure in being defiantly dirty. She tramped straight through puddles; she wallowed in mud. In the wood-lot was long grass which soaked her stockings till her ankles felt itchy. Claire had never expected to be so very intimate with a brush-pile. She became so. As though she were a pioneer woman who had been toiling here for years, she came to know the brush stick by stick—the long valuable branch that she could never quite get out from under the others; the thorny bough that pricked her hands every time she tried to reach the curious bundle of switches.


Seven trips she made, carrying armfuls of twigs and solemnly dragging large boughs behind her. She patted them down in front of all four wheels. Her crisp hands looked like the paws of a three-year-old boy making a mud fort. Her nails hurt from the mud wedged beneath them. Her mud-caked shoes were heavy to lift. It was with exquisite self-approval that she sat on the running-board, scraped a car-load of lignite off her soles, climbed back into the car, punched the starter.

mudhapticcar partpleasuremaintenance


The car stirred, crept forward one inch, and settled back—one inch. The second time it heaved encouragingly but did not make quite so much headway. Then Claire did sob.

affectaccident


She rubbed her cheek against the comfortable, rough, heather-smelling shoulder of her father's coat, while he patted her and smiled, "Good girl! I better get out and help."


She sat straight, shook her head. "Nope. I'll do it. And I'm not going to insist on being heroic any longer. I'll get a farmer to pull us out."


As she let herself down into the ooze, she reflected that all farmers have hearts of gold, anatomical phenomena never found among the snobs and hirelings of New York. The nearest heart of gold was presumably beating warmly in the house a quarter of a mile ahead.


She came up a muddy lane to a muddy farmyard, with a muddy cur yapping at her wet legs, and geese hissing in a pool of purest mud serene. The house was small and rather old. It may have been painted once. The barn was large and new. It had been painted very much, and in a blinding red with white trimmings. There was no brass plate on the house, but on the barn, in huge white letters, was the legend, "Adolph Zolzac, 1913."


She climbed by log steps to a narrow frame back porch littered with
parts of a broken cream-separator. She told herself that she was simple and friendly in going to the back door instead of the front, and it was with gaiety that she knocked on the ill-jointed screen door, which flapped dismally in response.


"Ja?" from within.


She rapped again.


"Hinein!"


She opened the door on a kitchen, the highlight of which was a table heaped with dishes of dumplings and salt pork. A shirt-sleeved man, all covered with mustache and calm, sat by the table, and he kept right on sitting as he inquired:


"Vell?"


"My car—my automobile—has been stuck in the mud. A bad driver, I'm afraid! I wonder if you would be so good as to——"

caraccidentmudroad conditionskill


"I usually get t'ree dollars, but I dunno as I vant to do it for less than four. Today I ain'd feelin' very goot," grumbled the golden-hearted.


Claire was aware that a woman whom she had not noticed—so much smaller than the dumplings, so much less vigorous than the salt pork was she—was speaking: "Aber, papa, dot's a shame you sharge de poor young lady dot, when she drive by sei self. Vot she t'ink of de Sherman people?"


The farmer merely grunted. To Claire, "Yuh, four dollars. Dot's what I usually charge sometimes."


"Usually? Do you mean to say that you leave that hole there in the road right along—that people keep on trying to avoid it and get stuck as I was? Oh! If I were an official——"

road condition


"Vell, I dunno, I don't guess I run my place to suit you smart alecks——"


"Papa! How you talk on the young lady! Make shame!"


"—from the city. If you don't like it, you stay bei Mineapolis! I haul you out for t'ree dollars and a half. Everybody pay dot. Last mont' I make forty-five dollars. They vos all glad to pay. They say I help them fine. I don't see vot you're kickin' about! Oh, these vimmins!"


"It's blackmail! I wouldn't pay it, if it weren't for my father sitting waiting out there. But—go ahead. Hurry!"


She sat tapping her toe while Zolzac completed the stertorous task of hogging the dumplings, then stretched, yawned, scratched, and covered his merely dirty garments with overalls that were apparently woven of processed mud. When he had gone to the barn for his team, his wife came to Claire. On her drained face were the easy tears of the slave women.


"Oh, miss, I don't know vot I should do. My boys go on the public school, and they speak American just so goot as you. Oh, I vant man lets me luff America. But papa he says it is an Unsinn; you got the money, he says, nobody should care if you are American or Old Country people. I should vish I could ride once in an automobile! But—I am so 'shamed, so 'shamed that I must sit and see my Mann make this. Forty years I been married to him, and pretty soon I die——"

gender


Claire patted her hand. There was nothing to say to tragedy that had outlived hope.


Adolph Zolzac clumped out to the highroad behind his vast, rolling-flanked horses—so much cleaner and better fed than his wisp of a wife. Claire followed him, and in her heart she committed murder and was glad of it. While Mr. Boltwood looked out with mild wonder at Claire's new friend, Zolzac hitched his team to the axle. It did not seem possible that two horses could pull out the car where seventy horsepower had fainted. But, easily, yawning and thinking about dinner, the horses drew the wheels up on the mud-bank, out of the hole and

animalcar part


The harness broke, with a flying mess of straps and rope, and the car plumped with perfect exactness back into its bed.

caraccident


Chapter III


A YOUNG MAN IN A RAINCOAT (21-35)


"Huh! Such an auto! Look, it break my harness a'ready! Two dollar that cost you to mend it. De auto iss too heavy!" stormed Zolzac.

car


"All right! All right! Only for heaven's sake—go get another harness!" Claire shrieked.


"Fife-fifty dot will be, in all." Zolzac grinned.


Claire was standing in front of him. She was thinking of other drivers, poor people, in old cars, who had been at the mercy of this golden-hearted one. She stared past him, in the direction from which she had come. Another motor was in sight.

driverclass


It was a tin beetle of a car; that agile, cheerful, rut-jumping model known as a "bug"; with a home-tacked, home-painted tin cowl and tail covering the stripped chassis of a little cheap Teal car. The lone driver wore an old black raincoat with an atrocious corduroy collar, and a new plaid cap in the Harry Lauder tartan. The bug skipped through mud where the Boltwoods' Gomez had slogged and rolled. Its pilot drove up behind her car, and leaped out. He trotted forward to Claire and Zolzac. His eyes were twenty-seven or eight, but his pink cheeks were twenty, and when he smiled—shyly, radiantly—he was no age at all, but eternal boy. Claire had a blurred impression that she had seen him before, some place along the road.

car modelaffectdrivermudcar part


"Stuck?" he inquired, not very intelligently. "How much is Adolph charging you?"


"He wants three-fifty, and his harness broke, and he wants two dollars——"


"Oh! So he's still working that old gag! I've heard all about Adolph. He keeps that harness for pulling out cars, and it always busts. The last time, though, he only charged six bits to get it mended. Now let me reason with him."


The young man turned with vicious quickness, and for the first time Claire heard pidgin German—German as it is spoken between Americans who have never learned it, and Germans who have forgotten it:


"Schon sex hundred times Ich höre all about the way you been doing autos, Zolzac, you verfluchter Schweinhund, and I'll set the sheriff on you——"


"Dot ain'd true, maybe einmal die Woche kommt somebody and Ich muss die Arbeit immer lassen und in die Regen ausgehen, und seh' mal how die boots sint mit mud covered, two dollars it don't pay for dis boots——"


"Now that's enough-plenty out of you, seien die boots verdammt, and mach' dass du fort gehst—muddy boots, hell!—put mal ein egg in die boots and beat it, verleicht maybe I'll by golly arrest you myself, weiss du! I'm a special deputy sheriff."


The young man stood stockily. He seemed to swell as his somewhat muddy hand was shaken directly at, under, and about the circumference of, Adolph Zolzac's hairy nose. The farmer was stronger, but he retreated. He took up the reins. He whined, "Don't I get nothing I break de harness?"


"Sure. You get ten—years! And you get out!"


From thirty yards up the road, Zolzac flung back, "You t'ink you're pretty damn smart!" That was his last serious reprisal.


Clumsily, as one not used to it, the young man lifted his cap to Claire, showing straight, wiry, rope-colored hair, brushed straight back from a rather fine forehead. "Gee, I was sorry to have to swear and holler like that, but it's all Adolph understands. Please don't think there's many of the folks around here like him. They say he's the meanest man in the county."


"I'm immensely grateful to you, but—do you know much about motors? How can I get out of this mud?"

carmud


She was surprised to see the youngster blush. His clear skin flooded. His engaging smile came again, and he hesitated, "Let me pull you out."


She looked from her hulking car to his mechanical flea.

car modelmetaphor


He answered the look: "I can do it all right. I'm used to the gumbo—regular mud-hen. Just add my power to yours. Have you a tow-rope?"

mudequipment


"No. I never thought of bringing one."


"I'll get mine."


She walked with him back toward his bug. It lacked not only top and side-curtains, but even windshield and running-board. It was a toy—a card-board box on toothpick axles. Strapped to the bulging back was a wicker suitcase partly covered by tarpaulin. From the seat peered a little furry face.

car modelcar partpleasuremetaphoranimal


"A cat?" she exclaimed, as he came up with a wire rope, extracted from the tin back.

animalcar partequipment


"Yes. She's the captain of the boat. I'm just the engineer."

drivermetaphoranimal


"What is her name?"


Before he answered the young man strode ahead to the front of her car, Claire obediently trotting after him. He stooped to look at her front axle. He raised his head, glanced at her, and he was blushing again.

car part


"Her name is Vere de Vere!" he confessed. Then he fled back to his bug. He drove it in front of the Gomez-Dep. The hole in the road itself was as deep as the one on the edge of the cornfield, where she was stuck, but he charged it. She was fascinated by his skill. Where she would for a tenth of a second have hesitated while choosing the best course, he hurled the bug straight at the hole, plunged through with sheets of glassy black water arching on either side, then viciously twisted the car to the right, to the left, and straight again, as he followed the tracks with the solidest bottoms.

driverskillcar modelroad condition


Strapped above the tiny angle-iron step which replaced his running-board was an old spade. He dug channels in front of the four wheels of her car, so that they might go up inclines, instead of pushing against the straight walls of mud they had thrown up. On these inclines he strewed the brush she had brought, halting to ask, with head alertly lifted from his stooped huddle in the mud, "Did you have to get this brush yourself?"

car partmud


"Yes. Horrid wet!"


He merely shook his head in commiseration.


He fastened the tow-rope to the rear axle of his car, to the front of hers. "Now will you be ready to put on all your power as I begin to pull?" he said casually, rather respectfully.

equipmentcar part


When the struggling bug had pulled the wire rope taut, she opened the throttle. The rope trembled. Her car seemed to draw sullenly back. Then it came out—out—really out, which is the most joyous sensation any motorist shall ever know. In excitement over actually moving again, as fast as any healthy young snail, she drove on, on, the young man ahead grinning back at her. Nor did she stop, nor he, till both cars were safe on merely thick mud, a quarter of a mile away.

car modelcar partequipmentpleasureroad conditiondriving


She switched off the power—and suddenly she was in a whirlwind of dizzy sickening tiredness. Even in her abandonment to exhaustion she noticed that the young man did not stare at her but, keeping his back to her, removed the tow-rope, and stowed it away in his bug. She wondered whether it was tact or yokelish indifference.

equipmentcar model


Her father spoke for the first time since the Galahad of the tin bug had come: "How much do you think we ought to give this fellow?"

metaphorcar model


Now of all the cosmic problems yet unsolved, not cancer nor the future of poverty are the flustering questions, but these twain: Which is worse, not to wear evening clothes at a party at which you find every one else dressed, or to come in evening clothes to a house where, it proves, they are never worn? And: Which is worse, not to tip when a tip has been expected; or to tip, when the tip is an insult?


In discomfort of spirit and wetness of ankles Claire shuddered, "Oh dear, I don't believe he expects us to pay him. He seems like an awfully independent person. Maybe we'd offend him if we offered——"


"The only reasonable thing to be offended at in this vale of tears is not being offered money!"


"Just the same—— Oh dear, I'm so tired. But good little Claire will climb out and be diplomatic."


She pinched her forehead, to hold in her cracking brain, and wabbled out into new scenes of mud and wetness, but she came up to the young man with the most rain-washed and careless of smiles. "Won't you come back and meet my father? He's terribly grateful to you—as I am. And may we—— You've worked so hard, and about saved our lives. May I pay you for that labor? We're really much indebted——"


"Oh, it wasn't anything. Tickled to death if I could help you."


He heartily shook hands with her father, and he droned, "Pleased to meet you, Mr. Uh."


"Boltwood."


"Mr. Boltwood. My name is Milt—Milton Daggett. See you have a New York license on your car. We don't see but mighty few of those through here. Glad I could help you."


"Ah yes, Mr. Daggett." Mr. Boltwood was uninterestedly fumbling in his money pocket. Behind Milt Daggett, Claire shook her head wildly, rattling her hands as though she were playing castanets. Mr. Boltwood shrugged. He did not understand. His relations with young men in cheap raincoats were entirely monetary. They did something for you, and you paid them—preferably not too much—and they ceased to be. Whereas Milt Daggett respectfully but stolidly continued to be, and Mr. Henry Boltwood's own daughter was halting the march of affairs by asking irrelevant questions:


"Didn't we see you back in—what was that village we came through back about twelve miles?"


"Schoenstrom?" suggested Milt.


"Yes, I think that was it. Didn't we pass you or something? We stopped at a garage there, to change a tire."

garage


"I don't think so. I was in town, though, this morning. Say, uh, did you and your father grab any eats——"


"A——"


"I mean, did you get dinner there?"


"No. I wish we had!"


"Well say, I didn't either, and—I'd be awfully glad if you folks would have something to eat with me now."


Claire tried to give him a smile, but the best she could do was to lend him one. She could not associate interesting food with Milt and his mud-slobbered, tin-covered, dun-painted Teal bug. He seemed satisfied with her dubious grimace. By his suggestion they drove ahead to a spot where the cars could be parked on firm grass beneath oaks. On the way, Mr. Boltwood lifted his voice in dismay. His touch of nervous prostration had not made him queer or violent; he retained a touching faith in good food.

driverdrivingcar model


"We might find some good little hotel and have some chops and just some mushrooms and peas," insisted the man from Brooklyn Heights.


"Oh, I don't suppose the country hotels are really so awfully good," she speculated. "And look—that nice funny boy. We couldn't hurt his feelings. He's having so much fun out of being a Good Samaritan."


From the mysterious rounded back of his car Milt Daggett drew a tiny stove, to be heated by a can of solidified alcohol, a frying pan that was rather large for dolls but rather small for square-fingered hands, a jar of bacon, eggs in a bag, a coffee pot, a can of condensed milk, and a litter of unsorted tin plates and china cups. While, by his request, Claire scoured the plates and cups, he made bacon and eggs and coffee, the little stove in the bottom of his car sheltered by the cook's bending over it. The smell of food made Claire forgiving toward the fact that she was wet through; that the rain continued to drizzle down her neck.


He lifted his hand and demanded, "Take your shoes off!"


"Uh?"


He gulped. He stammered, "I mean—I mean your shoes are soaked through. If you'll sit in the car, I'll put your shoes up by the engine. It's pretty well heated from racing it in the mud. You can get your stockings dry under the cowl."

enginedrivingmudcar part


She was amused by the elaborateness with which he didn't glance at her while she took off her low shoes and slipped her quite too thin black stockings under the protecting tin cowl. She reflected, "He has such a nice, awkward gentleness. But such bad taste! They're really quite good ankles. Apparently ankles are not done, in Teal bug circles. His sisters don't even have limbs. But do fairies have sisters? He is a fairy. When I'm out of the mud he'll turn his raincoat into a pair of lordly white wings, and vanish. But what will become of the cat?"

car partcar modelmetaphor


Thus her tired brain, like a squirrel in a revolving cage, while she sat primly and scraped at a clot of rust on a tin plate and watched him put on the bacon and eggs. Wondering if cats were used for this purpose in the Daggett family, she put soaked, unhappy Vere de Vere on her feet, to her own great comfort and the cat's delight. It was an open car, and the rain still rained, and a strange young man was a foot from her tending the not very crackly fire, but rarely had Claire felt so domestic.

carrainaffect


Milt was apparently struggling to say something. After several bobs of his head he ventured, "You're so wet! I'd like for you to take my raincoat."


"No! Really! I'm already soaked through. You keep dry."


He was unhappy about it. He plucked at a button of the coat. She turned him from the subject. "I hope Lady Vere de Vere is getting warm, too."


"Seems to be. She's kind of demanding. She wanted a little car of her own, but I didn't think she could keep up with me, not on a long hike."

caranimal


"A little car? With her paws on the tiny wheel? Oh—sweet! Are you going far, Mr. Daggett?"

carcar partanimal


"Yes, quite a ways. To Seattle, Washington."


"Oh, really? Extraordinary. We're going there, too."


"Honest? You driving all the way? Oh, no, of course your father——"


"No, he doesn't drive. By the way, I hope he isn't too miserable back there."


"I'll be darned. Both of us going to Seattle. That's what they call a coincidence, isn't it! Hope I'll see you on the road, some time. But I don't suppose I will. Once you're out of the mud, your Gomez will simply lose my Teal."

car model


"Not necessarily. You're the better driver. And I shall take it easy. Are you going to stay long in Seattle?" It was not merely a polite dinner-payment question. She wondered; she could not place this fresh-cheeked, unworldly young man so far from his home.

skilldriver


"Why, I kind of hope—— Government railroad, Alaska. I'm going to try to get in on that, somehow. I've never been out of Minnesota in my life, but there's couple mountains and oceans and things I thought I'd like to see, so I just put my suitcase and Vere de Vere in the machine, and started out. I burn distillate instead of gas, so it doesn't cost much. If I ever happen to have five whole dollars, why, I might go on to Japan!"

trainmetaphorresourcesgasoline


"That would be jolly."


"Though I s'pose I'd have to eat—what is it?—pickled fish? There's a woman from near my town went to the Orient as a missionary. From what she says, I guess all you need in Japan to make a house is a bottle of mucilage and a couple of old newspapers and some two-by-fours. And you can have the house on a purple mountain, with cherry trees down below, and——" He put his clenched hand to his lips. His head was bowed. "And the ocean! Lord! The ocean! And we'll see it at Seattle. Bay, anyway. And steamers there—just come from India! Huh! Getting pretty darn
poetic here! Eggs are done."


The young man did not again wander into visions. He was all briskness as he served her bacon and eggs, took a plate of them to Mr. Boltwood in the Gomez, gouged into his own. Having herself scoured the tin plates, Claire was not repulsed by their naked tinniness; and the coffee in the broken-handled china cup was tolerable. Milt drank from the top of a vacuum bottle. He was silent. Immediately after the lunch he stowed the things away. Claire expected a drawn-out, tact-demanding farewell, but he climbed into his bug, said "Good-by, Miss Boltwood. Good luck!" and
was gone.

car model


The rainy road was bleakly empty without him.

rainroad condition


It did not seem possible that Claire's body could be nagged into going on any longer. Her muscles were relaxed, her nerves frayed. But the moment the Gomez started, she discovered that magic change which every long-distance motorist knows. Instantly she was alert, seemingly able to drive forever. The pilot's instinct ruled her; gave her tireless eyes and sturdy hands. Surely she had never been weary; never would be, so long as it was hers to keep the car going.

car modelpleasuredriverskill


She had driven perhaps six miles when she reached a hamlet called St. Klopstock. On the bedraggled mud-and-shanty main street a man was loading crushed rock into a truck. By him was a large person in a prosperous raincoat, who stepped out, held up his hand. Claire stopped.

road conditionmudtruck


"You the young lady that got stuck in that hole by Adolph Zolzac's?"

accidentroad condition


"Yes. And Mr. Zolzac wasn't very nice about it."


"He's going to be just elegant about it, now, and there ain't going to be any more hole. I think Adolph has been keeping it muddy—throwing in soft dirt—and he made a good and plenty lot out of pulling out tourists. Bill and I are going down right now and fill it up with stone. Milt Daggett come through here—he's got a nerve, that fellow, but I did have to laugh—he says to me, 'Barney——' This was just now. He hasn't more than just drove out of town. He said to me, 'Barney,' he says, 'you're the richest man in this township, and the banker, and you got a big car y'self, and you think you're one whale of a political boss,' he says, 'and yet you let that Zolzac maintain a private ocean, against the peace and damn horrible inconvenience of the Commonwealth of Minnesota——' He's got a great line of talk, that fellow. He told me how you got stuck—made me so ashamed—I been to New York myself—and right away I got Bill, and we're going down and hold a donation and surprise party on Adolph and fill that hole."

mudroad conditionaccident


"But won't Adolph dig it out again?"


The banker was puffy, but his eyes were of stone. From the truck he took a shotgun. He drawled, "In that case, the surprise party will include an elegant wake."


"But how did—— Who is this extraordinary Milt Daggett?"


"Him? Oh, nobody 'specially. He's just a fellow down here at Schoenstrom. But we all know him. Goes to all the dances, thirty miles around. Thing about him is: if he sees something wrong, he picks out some poor fellow like me, and says what he thinks."


Claire drove on. She was aware that she was looking for Milt's bug. It was not in sight.

drivingcar model


"Father," she exclaimed, "do you realize that this lad didn't tell us he was going to have the hole filled? Just did it. He frightens me. I'm afraid that when we reach Gopher Prairie for the night, we'll find he has engaged for us the suite that Prince Collars and Cuffs once slept in."


"Hhhhmm," yawned her father.


"Curious young man. He said, 'Pleased to meet you.'"


"Huuuuhhm! Fresh air makes me so sleepy."


"And—— Fooled you! Got through that mudhole, anyway! And he said—— Look! Fields stretch out so here, and not a tree except the willow-groves round those farmhouses. And he said 'Gee' so many times, and 'dinner' for the noon meal. And his nails—— No, I suppose he really is just a farm youngster."

skillclass


Mr. Boltwood did not answer. His machine-finish smile indicated an enormous lack of interest in young men in Teal bugs.

car model


Chapter IV


A ROOM WITHOUT (36-48)


Gopher Prairie has all of five thousand people. Its commercial club asserts that it has at least a thousand more population and an infinitely better band than the ridiculously envious neighboring town of Joralemon. But there were few signs that a suite had been engaged for the Boltwoods, or that Prince Collars and Cuffs had on his royal tour of America spent much time in Gopher Prairie. Claire reached it somewhat before seven. She gaped at it in a hazy way. Though this was her first prairie town for a considerable stay, she could not pump up interest.


The state of mind of the touring motorist entering a strange place at night is as peculiar and definite as that of a prospector. It is compounded of gratitude at having got safely in; of perception of a new town, yet with all eagerness about new things dulled by weariness; of hope that there is going to be a good hotel, but small expectation—and absolutely no probability—that there really will be one.

drivermetaphoraffect


Claire had only a blotched impression of peaked wooden buildings and squatty brick stores with faded awnings; of a red grain elevator and a crouching station and a lumberyard; then of the hopelessly muddy road leading on again into the country. She felt that if she didn't stop at once, she would miss the town entirely. The driving-instinct sustained her, made her take corners sharply, spot a garage, send the Gomez whirling in on the cement floor.

mudroad conditionskillcar modelpersonificationvisibilitygarage


The garage attendant looked at her and yawned.

garage


"Where do you want the car?" Claire asked sharply.


"Oh, stick it in that stall," grunted the man, and turned his back.


Claire glowered at him. She thought of a good line about rudeness.

But—oh, she was too tired to fuss. She tried to run the car into the empty stall, which was not a stall, but a space, like a missing tooth, between two cars, and so narrow that she was afraid of crumpling the lordly fenders of the Gomez. She ran down the floor, returned with a flourish, thought she was going to back straight into the stall—and found she wasn't. While her nerves shrieked, and it did not seem possible that she could change gears, she managed to get the Gomez behind a truck and side-on to the stall.

car partparkingaffect


"Go forward again, and cramp your wheel—sharp!" ordered the garage man.

parkingcar part


Claire wanted to outline what she thought of him, but she merely demanded, "Will you kindly drive it in?"

affectparking


"Why, sure. You bet," said the man casually. His readiness ruined her inspired fury. She was somewhat disappointed.


As she climbed out of the car and put a hand on the smart bags strapped on a running-board, the accumulated weariness struck her in a shock. She could have driven on for hours, but the instant the car was safe for the night, she went to pieces. Her ears rang, her eyes were soaked in fire, her mouth was dry, the back of her neck pinched. It was her father who took the lead as they rambled to the one tolerable hotel in the town.

car partdriveraffect


In the hotel Claire was conscious of the ugliness of the poison-green walls and brass cuspidors and insurance calendars and bare floor of the office; conscious of the interesting scientific fact that all air had been replaced by the essence of cigar smoke and cooking cabbage; of the stares of the traveling men lounging in bored lines; and of the lack of welcome on the part of the night clerk, an oldish, bleached man with whiskers instead of a collar.


She tried to be important: "Two rooms with bath, please."


The bleached man stared at her, and shoved forward the register and a pen clotted with ink. She signed. He took the bags, led the way to the stairs. Anxiously she asked, "Both rooms are with bath?"


From the second step the night clerk looked down at her as though she were a specimen that ought to be pinned on the corks at once, and he said loudly, "No, ma'am. Neither of 'em. Got no rooms vacant with bawth, or bath either! Not but what we got 'em in the house. This is an up-to-date place. But one of 'm's took, and the other has kind of been out of order, the last three-four months."


From the audience of drummers below, a delicate giggle.


Claire was too angry to answer. And too tired. When, after miles of stairs, leagues of stuffy hall, she reached her coop, with its iron bed so loose-jointed that it rattled to a breath, its bureau with a list to port, and its anemic rocking-chair, she dropped on the bed, panting, her eyes closed but still brimming with fire. It did not seem that she could ever move again. She felt chloroformed. She couldn't even coax herself off the bed, to see if her father was any better off in the next room.


She was certain that she was not going to drive to Seattle. She wasn't going to drive anywhere! She was going to freight the car back to Minneapolis, and herself go back by train—Pullman!—drawing-room!

drivertrainbusaffect


But for the thought of her father she would have fallen asleep, in her drenched tweeds. When she did force the energy to rise, she had to support herself by the bureau, by the foot of the bed, as she moved about the room, hanging up the wet suit, rubbing herself with a slippery towel, putting on a dark silk frock and pumps. She found her father sitting motionless in his room, staring at the wall. She made herself laugh at him for his gloomy emptiness. She paraded down the hall with him.


As they reached the foot of the stairs, the old one, the night clerk leaned across the desk and, in a voice that took the whole office into the conversation, quizzed, "Come from New York, eh? Well, you're quite a ways from home."


Claire nodded. She felt shyer before these solemnly staring traveling men than she ever had in a box at the opera. At the double door of the dining-room, from which the cabbage smell steamed with a lustiness undiminished by the sad passing of its youth, a man, one of the average-sized, average-mustached, average business-suited, average-brown-haired men who can never be remembered, stopped the Boltwoods and hawed, "Saw you coming into town. You've got a New York license?"


She couldn't deny it.


"Quite a ways from home, aren't you?"


She had to admit it.


She was escorted by a bouncing, black-eyed waitress to a table for four. The next table was a long one, at which seven traveling men, or local business men whose wives were at the lake for the summer, ceased trying to get nourishment out of the food, and gawped at her. Before the Boltwoods were seated, the waitress dabbed at non-existent spots on their napkins, ignored a genuine crumb on the cloth in front of Claire's plate, made motions at a cup and a formerly plated fork, and bubbled, "Autoing through?"

cardriving


Claire fumbled for her chair, oozed into it, and breathed, "Yes."


"Going far?"


"Yes."


"Where do you live?"


"New York."


"My! You're quite a ways from home, aren't you?"


"Apparently."


"Hamnegs roasbeef roaspork thapplesauce frypickerel springlamintsauce."


"I—I beg your pardon."


The waitress repeated.


"I—oh—oh, bring us ham and eggs. Is that all right, father?"


"Oh—no—well——"


"You wanted same?" the waitress inquired of Mr. Boltwood.


He was intimidated. He said, "If you please," and feebly pawed at a
fork.


The waitress was instantly back with soup, and a collection of china gathered by a man of much travel, catholic interests, and no taste. One of the plates alleged itself to belong to a hotel in Omaha. She pushed a pitcher of condensed milk to the exact spot where it would catch Mr. Boltwood's sleeve, brushed the crumb from in front of Claire to a shelter beneath the pink and warty sugar bowl, recovered a toothpick which had been concealed behind her glowing lips, picked for a while, gave it up, put her hands on her hips, and addressed Claire:


"How far you going?"


"To Seattle."


"Got any folks there?"


"Any—— Oh, yes, I suppose so."


"Going to stay there long?"


"Really—— We haven't decided."


"Come from New York, eh? Quite a ways from home, all right. Father in business there?"


"Yes."


"What's his line?"


"I beg pardon?"


"What's his line? Ouch! Jiminy, these shoes pinch my feet. I used to could dance all night, but I'm getting fat, I guess, ha! ha! Put on seven pounds last month. Ouch! Gee, they certainly do pinch my toes. What business you say your father's in?"


"I didn't say, but—— Oh, railroad."

train


"G. N. or N. P.?"


"I don't think I quite understand——"


Mr. Boltwood interposed, "Are the ham and eggs ready?"


"I'll beat it out and see." When she brought them, she put a spoon in Claire's saucer of peas, and demanded, "Say, you don't wear that silk dress in the auto, do you?"

driver


"No."


"I should think you'd put a pink sash on it. Seems like it's kind of plain—it's a real pretty piece of goods, though. A pink sash would be real pretty. You dark-complected ladies always looks better for a touch of color."


Then was Claire certain that the waitress was baiting her, for the amusement of the men at the long table. She exploded. Probably the waitress did not know there had been an explosion when Claire looked coldly up, raised her brows, looked down, and poked the cold and salty slab of ham, for she was continuing:


"A light-complected lady like me don't need so much color, you notice my hair is black, but I'm light, really, Pete Liverquist says I'm a blonde brunette, gee, he certainly is killing that fellow, oh, he's a case, he sure does like to hear himself talk, my! there's Old Man Walters, he runs the telephone exchange here, I heard he went down to St. Cloud on Number 2, but I guess he couldn't of, he'll be yodeling for friend soup and a couple slabs of moo, I better beat it, I'll say so, so long."


Claire's comment was as acid as the pale beets before her, as bitter as the peas, as hard as the lumps in the watery mashed potatoes:


"I don't know whether the woman is insane or ignorant. I wish I could tell whether she was trying to make me angry for the benefit of those horrid unshaven men, or merely for her private edification."


"By me, dolly. So is this pie. Let's get some medium to levitate us up to bed. Uh—uh—— I think perhaps we'd better not try to drive clear to Seattle. If we just went through to Montana?—or even just to Bismarck?"


"Drive through with the hotels like this? My dear man, if we have one more such day, we stop right there. I hope we get by the man at the desk. I have a feeling he's lurking there, trying to think up something insulting to say to us. Oh, my dear, I hope you aren't as beastly tired as I am. My bones are hot pokers."


The man at the desk got in only one cynical question, "Driving far?" before Claire seized her father's arm and started him upstairs.


For the first time since she had been ten—and in a state of naughtiness immediately following a pronounced state of grace induced by the pulpit oratory of the new rector of St. Chrysostom's—she permitted herself the luxury of not stopping to brush her teeth before she went to bed. Her sleep was drugged—it was not sleep, but an aching exhaustion of the body which did not prevent her mind from revisualizing the road, going stupidly over the muddy stretches and sharp corners, then becoming conscious of that bed, the lump under her shoulder blades, the slope to westward, and the creak that rose every time she tossed. For at least fifteen minutes she lay awake for hours.

driveraffectroad


Thus Claire Boltwood's first voyage into democracy.


It was not so much that the sun was shining, in the morning, as that a ripple of fresh breeze came through the window. She discovered that she again longed to go on—keep going on—see new places, conquer new roads. She didn't want all good road. She wanted something to struggle against. She'd try it for one more day. She was stiff as she crawled out of bed, but a rub with cold water left her feeling that she was stronger than she ever had been; that she was a woman, not a dependent girl. Already, in the beating prairie sun-glare, the wide main street of Gopher Prairie was drying; the mud ruts flattening out. Beyond the town hovered the note of a meadow lark—sunlight in sound.

driveraffectgenderroad conditionmud


"Oh, it's a sweet morning! Sweet! We will go on! I'm terribly excited!" she laughed.


She found her father dressed. He did not know whether or not he wanted to go on. "I seem to have lost my grip on things. I used to be rather decisive. But we'll try it one more day, if you like," he said.


When she had gaily marched him downstairs, she suddenly and unhappily remembered the people she would have to face, the gibing questions she would have to answer.


The night clerk was still at the desk, as though he had slept standing. He hailed them. "Well, well! Up bright and early! Hope you folks slept well. Beds aren't so good as they might be, but we're kind of planning to get some new mattresses. But you get pretty good air to sleep in. Hope you have a fine hike today."


His voice was cordial; he was their old friend; faithful watcher of their progress. Claire found herself dimpling at him.


In the dining-room their inquisitional acquaintance, the waitress, fairly ran to them. "Sit down, folks. Waffles this morning. You want to stock up for your drive. My, ain't it an elegant morning! I hope you have a swell drive today!"


"Why!" Claire gasped, "why, they aren't rude. They care—about people they never saw before. That's why they ask questions! I never thought—I never thought! There's people in the world who want to know us without having looked us up in the Social Register! I'm so ashamed! Not that the sunshine changes my impression of this coffee. It's frightful! But that will improve. And the people—they were being friendly, all the time. Oh, Henry B., young Henry Boltwood, you and your godmother Claire have a lot to learn about the world!"


As they came into the garage, their surly acquaintance of the night before looked just as surly, but Claire tried a boisterous "Good morning!"

garage


"Mornin'! Going north? Better take the left-hand road at Wakamin. Easier going. Drive your car out for you?"

parking


As the car stood outside taking on gas, a man flapped up, spelled out the New York license, looked at Claire and her father, and inquired, "Quite a ways from home, aren't you?"

gasolinegas station


This time Claire did not say "Yes!" She experimented with, "Yes, quite a ways."


"Well, hope you have a good trip. Good luck!"


Claire leaned her head on her hand, thought hard. "It's I who wasn't friendly," she propounded to her father. "How much I've been losing. Though I still refuse to like that coffee!"


She noticed the sign on the air-hose of the garage—"Free Air."

garage


"There's our motto for the pilgrimage!" she cried.

religionmetaphor


She knew the exaltation of starting out in the fresh morning for places she had never seen, without the bond of having to return at night.


Thus Claire's second voyage into democracy.


While she was starting the young man who had pulled her out of the mud and given her lunch was folding up the tarpaulin and blankets on which he had slept beside his Teal bug, in the woods three miles north of Gopher Prairie. To the high-well-born cat, Vere de Vere, Milt Daggett mused aloud, "Your ladyship, as Shakespeare says, the man that gets cold feet never wins the girl. And I'm scared, cat, clean scared."

car model


Chapter V


RELEASE BRAKES—SHIFT TO THIRD (49-65)


Milt Daggett had not been accurate in his implication that he had not noticed Claire at a garage in Schoenstrom. For one thing, he owned the garage.

garage


Milt was the most prosperous young man in the village of Schoenstrom. Neither the village itself nor the nearby Strom is really schoen. The entire business district of Schoenstrom consists of Heinie Rauskukle's general store, which is brick; the Leipzig House, which is frame; the Old Home Poolroom and Restaurant, which is of old logs concealed by a frame sheathing; the farm-machinery agency, which is galvanized iron, its roof like an enlarged washboard; the church; the three saloons; and the Red Trail Garage, which is also, according to various signs, the Agency for Teal Car Best at the Test, Stonewall Tire Service Station, Sewing Machines and Binders Repaired, Dr. Hostrum the Veterinarian every Thursday, Gas Today 27c.


The Red Trail Garage is of cement and tapestry brick. In the office is a clean hardwood floor, a typewriter, and a picture of Elsie Ferguson. The establishment has an automatic rim-stretcher, a wheel jack, and a reputation for honesty.


The father of Milt Daggett was the Old Doctor, born in Maine, coming to this frontier in the day when Chippewas camped in your dooryard, and came in to help themselves to coffee, which you made of roasted corn. The Old Doctor bucked northwest blizzards, read Dickens and Byron, pulled people through typhoid, and left to Milt his shabby old medicine case and thousands of dollars—in uncollectible accounts. Mrs. Daggett had long since folded her crinkly hands in quiet death.


Milt had covered the first two years of high school by studying with the priest, and been sent to the city of St. Cloud for the last two years. His father had meant to send him to the state university. But Milt had been born to a talent for machinery. At twelve he had made a telephone that worked. At eighteen he was engineer in the tiny flour mill in Schoenstrom. At twenty-five, when Claire Boltwood chose to come tearing through his life in a Gomez-Dep, Milt was the owner, manager, bookkeeper, wrecking crew, ignition expert, thoroughly competent bill-collector, and all but one of the working force of the Red Trail Garage.

car modelgarage


There were two factions in Schoenstrom: the retired farmers who said that German was a good enough language for anybody, and that taxes for schools and sidewalks were yes something crazy; and the group who stated that a pig-pen is a fine place, but only for pigs. To this second, revolutionary wing belonged a few of the first generation, most of the second, and all of the third; and its leader was Milt Daggett. He did not talk much, normally, but when he thought things ought to be done, he was as annoying as a machine-gun test in the lot next to a Quaker meeting.


If there had been a war, Milt would probably have been in it—rather casual, clearing his throat, reckoning and guessing that maybe his men might try going over and taking that hill ... then taking it. But all of this history concerns the year just before America spoke to Germany; and in this town buried among the cornfields and the wheat, men still thought more about the price of grain than about the souls of nations.


On the evening before Claire Boltwood left Minneapolis and adventured into democracy, Milt was in the garage. He wore union overalls that were tan where they were not grease-black; a faded blue cotton shirt; and the crown of a derby, with the rim not too neatly hacked off with a dull toad-stabber jack-knife.

garage


Milt smiled at his assistant, Ben Sittka, and suggested, "Well, wie geht 's mit the work, eh? Like to stay and get the prof's flivver out, so he can have it in the morning?"

mechaniccar model


"You bet, boss."


"Getting to be quite a mechanic, Ben."

mechanic


"I'll say so!"


"If you get stuck, come yank me out of the Old Home."


"Aw rats, boss. I'll finish it. You beat it." Ben grinned at Milt
adoringly.


Milt stripped off his overalls and derby-crown, and washed his big, firm hands with gritty soft soap. He cleaned his nails with a file which he carried in his upper vest pocket in a red imitation morocco case which contained a comb, a mirror, an indelible pencil, and a note-book with the smudged pencil addresses of five girls in St. Cloud, and a memorandum about Rauskukle's car.


He put on a twisted brown tie, an old blue serge suit, and a hat which, being old and shabby, had become graceful. He ambled up the street. He couldn't have ambled more than three blocks and have remained on the street. Schoenstrom tended to leak off into jungles of tall corn.


Two men waved at him, and one demanded, "Say, Milt, is whisky good for the toothache? What d' you think! The doc said it didn't do any good. But then, gosh, he's only just out of college."


"I guess he's right."


"Is that a fact! Well, I'll keep off it then."


Two stores farther on, a bulky farmer hailed, "Say, Milt, should I get an ensilage cutter yet?"


"Yuh," in the manner of a man who knows too much to be cocksure about anything, "I don't know but what I would, Julius."


"I guess I vill then."


Minnie Rauskukle, plump, hearty Minnie, heiress to the general store, gave evidence by bridling and straightening her pigeon-like body that she was aware of Milt behind her. He did not speak to her. He ducked into the door of the Old Home Poolroom and Restaurant.


Milt ranged up to the short lunch counter, in front of the pool table where two brick-necked farm youngsters were furiously slamming balls and attacking cigarettes. Loose-jointedly Milt climbed a loose-jointed high stool and to the proprietor, Bill McGolwey, his best friend, he yawned, "You might poison me with a hamburger and a slab of apple, Mac."


"I'll just do that little thing. Look kind of grouchy tonight, Milt."


"Too much excitement in this burg. Saw three people on the streets all simultaneously to-once."


"What's been eatin' you lately?"


"Me? Nothing. Only I do get tired of this metropolis. One of these days I'm going to buck some bigger place."


"Try Gopher Prairie maybe?" suggested Mac, through the hiss and steam of the frying hamburger sandwich.


"Rats. Too small."


"Small? Why, there's darn near five thousand people there!"


"I know, but—I want to tackle some sure-nuff city. Like Duluth or New York."


"But what'd you do?"


"That's the devil of it. I don't know just what I do want to do. I could always land soft in a garage, but that's nothing new. Might hit Detroit, and learn the motor-factory end."

garagetechnology


"Aw, you're the limit, Milt. Always looking for something new."


"That's the way to get on. The rest of this town is afraid of new things. 'Member when I suggested we all chip in on a dynamo with a gas engine and have electric lights? The hicks almost died of nervousness."


"Yuh, that's true, but—— You stick here, Milt. You and me will just nachly run this burg."


"I'll say! Only—— Gosh, Mac, I would like to go to a real show, once. And find out how radio works. And see 'em put in a big suspension bridge!"


Milt left the Old Home rather aimlessly. He told himself that he positively would not go back and help Ben Sittka get out the prof's car. So he went back and helped Ben get out the prof's car, and drove the same to the prof's. The prof, otherwise professor, otherwise mister, James Martin Jones, B.A., and Mrs. James Martin Jones welcomed him almost as noisily as had Mac. They begged him to come in. With Mr. Jones he discussed—no, ye Claires of Brooklyn Heights, this garage man and this threadbare young superintendent of a paintbare school, talking in a town that was only a comma on the line, did not discuss corn-growing, nor did they reckon to guess that by heck the constabule was carryin' on with the Widdy Perkins. They spoke of fish-culture, Elihu Root, the spiritualistic evidences of immortality, government ownership, self-starters for flivvers, and the stories of Irvin Cobb.

mechaniccar model


Milt went home earlier than he wanted to. Because Mr. Jones was the only man in town besides the priest who read books, because Mrs. Jones was the only woman who laughed about any topics other than children and family sickness, because he wanted to go to their house every night, Milt treasured his welcome as a sacred thing, and kept himself from calling on them more than once a week.


He stopped on his way to the garage to pet Emil Baumschweiger's large gray cat, publicly known as Rags, but to Milt and to the lady herself recognized as the unfortunate Countess Vere de Vere—perhaps the only person of noble ancestry and mysterious past in Milt's acquaintance. The Baumschweigers did not treat their animals well; Emil kicked the bay mare, and threw pitchforks at Vere de Vere. Milt saluted her and sympathized:


"You have a punk time, don't you, countess? Like to beat it to Minneapolis with me?"


The countess said that she did indeed have an extraordinarily punk time, and she sang to Milt the hymn of the little gods of the warm hearth. Then Milt's evening dissipations were over. Schoenstrom has movies only once a week. He sat in the office of his garage ruffling through a weekly digest of events. Milt read much, though not too easily. He had no desire to be a poet, an Indo-Iranian etymologist, a lecturer to women's clubs, or the secretary of state. But he did rouse to the marvels hinted in books and magazines; to large crowds, the mechanism of submarines, palm trees, gracious women.


He laid down the magazine. He stared at the wall. He thought about nothing. He seemed to be fumbling for something about which he could deliciously think if he could but grasp it. Without quite visualizing either wall or sea, he was yet recalling old dreams of a moonlit wall by a warm stirring southern sea. If there was a girl in the dream she was intangible as the scent of the night. Presently he was asleep, a not at all romantic figure, rather ludicrously tipped to one side in his office chair, his large solid shoes up on the desk.


He half woke, and filtered to what he called home—one room in the cottage of an oldish woman who had prejudices against the perilous night air. He was too sleepy to go through any toilet save pulling off his shoes, and achieving an unconvincing wash at the little stand, whose crackly varnish was marked with white rings from the toothbrush mug.


"I feel about due to pull off some fool stunt. Wonder what it will be?" he complained, as he flopped on the bed.


He was up at six, and at a quarter to seven was at work in the garage. He spent a large part of the morning in trying to prove to a customer that even a Teal car, best at the test, would not give perfect service if the customer persisted in forgetting to fill the oil-well, the grease-cups, and the battery.

garagecar partcar modelmaintenance


At three minutes after twelve Milt left the garage to go to dinner. The fog of the morning had turned to rain. McGolwey was not at the Old Home. Sometimes Mac got tired of serving meals, and for a day or two he took to a pocket flask, and among his former customers the cans of prepared meat at Rauskukle's became popular. Milt found him standing under the tin awning of the general store. He had a troubled hope of keeping Mac from too long a vacation with the pocket flask. But Mac was already red-eyed. He seemed only half to recognize Milt.


"Swell day!" said Milt.


"Y' bet."


"Road darn muddy."

road conditionmud


"I should worry. Yea, bo', I'm feelin' good!"


At eleven minutes past twelve a Gomez-Dep roadster appeared down the road, stopped at the garage. To Milt it was as exciting as the appearance of a comet to a watching astronomer.

car modelaffect


"What kind of a car do you call that, Milt?" asked a loafer.

car model


"Gomez-Deperdussin."

car model


"Never heard of it. Looks too heavy."


This was sacrilege. Milt stormed, "Why, you poor floof, it's one of the best cars in the world. Imported from France. That looks like a special-made American body, though. Trouble with you fellows is, you're always scared of anything that's new. Too—heavy! Huh! Always wanted to see a Gomez—never have, except in pictures. And I believe that's a New York license. Let me at it!"

car model


He forgot noon-hunger, and clumped through the rain to the garage. He saw a girl step from the car. He stopped, in the doorway of the Old Home, in uneasy shyness. He told himself he didn't "know just what it is about her—she isn't so darn unusually pretty and yet—gee—— Certainly isn't a girl to get fresh with. Let Ben take care of her. Like to talk to her, and yet I'd be afraid if I opened my mouth, I'd put my foot in it."

garage


He was for the first time seeing a smart woman. This dark, slender, fine-nerved girl, in her plain, rough, closely-belted, gray suit, her small black Glengarry cocked on one side of her smooth hair, her little kid gloves, her veil, was as delicately adjusted as an aeroplane engine.


Milt wanted to trumpet her exquisiteness to the world, so he growled to a man standing beside him, "Swell car. Nice-lookin' girl, kind of."

car modelgender


"Kind of skinny, though. I like 'em with some meat on 'em," yawned the man.


No, Milt did not strike him to earth. He insisted feebly, "Nice clothes she's got, though."


"Oh, not so muchamuch. I seen a woman come through here yesterday that was swell, though—had on a purple dress and white shoes and a hat big 's a bushel."


"Well, I don't know, I kind of like those simple things," apologized Milt.


He crept toward the garage. The girl was inside. He inspected the slope-topped, patent-leather motoring trunk on the rack at the rear of the Gomez-Dep. He noticed a middle-aged man waiting in the car. "Must be her father. Probably—maybe she isn't married then." He could not get himself to shout at the man, as he usually did. He entered the garage office; from the inner door he peeped at the girl, who was talking to his assistant about changing an inner tube.

garagecar partcar modelmechanic


That Ben Sittka whom an hour ago he had cajoled as a promising child he now admired for the sniffing calmness with which he was demanding, "Want a red or gray tube?"

car partmechanic


"Really, I don't know. Which is the better?" The girl's voice was curiously clear.


Milt passed Claire Boltwood as though he did not see her; stood at the rear of the garage kicking at the tires of a car, his back to her. Over and over he was grumbling, "If I just knew one girl like that—— Like a picture. Like—like a silver vase on a blue cloth!"

car part


Ben Sittka did not talk to the girl while he inserted the tube in the spare casing. Only, in the triumphant moment when the parted ends of the steel rim snapped back together, he piped, "Going far?"

car partmechanic


"Yes, rather. To Seattle."


Milt stared at the cobweb-grayed window. "Now I know what I was planning to do. I'm going to Seattle," he said.


The girl was gone at twenty-nine minutes after twelve. At twenty-nine and a half minutes after, Milt remarked to Ben Sittka, "I'm going to take a trip. Uh? Now don't ask questions. You take charge of the garage until you hear from me. Get somebody to help you. G'-by."

garage


He drove his Teal bug out of the garage. At thirty-two minutes after twelve he was in his room, packing his wicker suitcase by the method of throwing things in and stamping on the case till it closed. In it he had absolutely all of his toilet refinements and wardrobe except the important portion already in use. They consisted, according to faithful detailed report, of four extra pairs of thick yellow and white cotton socks; two shirts, five collars, five handkerchiefs; a pair of surprisingly vain dancing pumps; high tan laced boots; three suits of cheap cotton underclothes; his Sunday suit, which was dead black in color, and unimaginative in cut; four ties; a fagged toothbrush, a comb and hairbrush, a razor, a strop, shaving soap in a mug; a not very clean towel; and nothing else whatever.

car modelgarage


To this he added his entire library and private picture gallery, consisting of Ivanhoe, Ben-Hur, his father's copy of Byron, a wireless manual, and the 1916 edition of Motor Construction and Repairing: the art collection, one colored Sunday supplement picture of a princess lunching in a Provençe courtyard, and a half-tone of Colonel Paul Beck landing in an early military biplane. Under this last, in a pencil scrawl now blurred to grayness, Milt had once written, "This what Ill be aviator."


What he was to wear was a piercing trouble. Till eleven minutes past twelve that day he had not cared. People accepted his overalls at anything except a dance, and at the dances he was the only one who wore pumps. But in his discovery of Claire Boltwood he had perceived that dressing is an art. Before he had packed, he had unhappily pawed at the prized black suit. It had become stupid. "Undertaker!" he growled.


With a shrug which indicated that he had nothing else, he had exchanged his overalls for a tan flannel shirt, black bow tie, thick pigskin shoes, and the suit he had worn the evening before, his best suit of two years ago—baggy blue serge coat and trousers. He could not know it, but they were surprisingly graceful on his wiry, firm, white body.


In his pockets were a roll of bills and an unexpectedly good gold watch. For warmth he had a winter ulster, an old-fashioned turtle-neck sweater, and a raincoat heavy as tarpaulin. He plunged into the raincoat, ran out, galloped to Rauskukle's store, bought the most vehement cap in the place—a plaid of cerise, orange, emerald green, ultramarine, and five other guaranteed fashionable colors. He stocked up with food for roadside camping.


In the humping tin-covered tail of the bug was a good deal of room, and this he filled with motor extras, a shotgun and shells, a pair of skates, and all his camping kit as used on his annual duck-hunting trip to Man Trap Lake.

car partcar modelmetaphorequipment


"I'm a darned fool to take everything I own but—— Might be gone a whole month," he reflected.


He had only one possession left—a check book, concealed from the interested eye of his too maternal landlady by sticking it under the stair carpet. This he retrieved. It showed a balance of two hundred dollars. There was ten dollars in the cash register in the office, for Ben Sittka. The garage would, with the mortgage deducted, be worth nearly two thousand. This was his fortune.


He bolted into the kitchen and all in one shout he informed his landlady, "Called out of town, li'l trip, b'lieve I don't owe you an'thing, here's six dollars, two weeks' notice, dunno just when I be back."


Before she could issue a questionnaire he was out in the bug. He ran through town. At his friend McGolwey; now loose-lipped and wabbly, sitting in the rain on a pile of ties behind the railroad station, he yelled, "So long, Mac. Take care yourself, old hoss. Off on li'l trip."

car modeldrivingspeed


He stopped in front of the "prof's," tooted till the heads of the Joneses appeared at the window, waved and shouted, "G'-by, folks. Goin' outa town."


Then, while freedom and the distant Pacific seemed to rush at him over the hood, he whirled out of town. It was two minutes to one—forty-seven minutes since Claire Boltwood had entered Schoenstrom.

drivingspeedaffectcar part


He stopped only once. His friend Lady Vere de Vere was at the edge of town, on a scientific exploring trip in the matter of ethnology and field mice. She hailed him, "Mrwr? Me mrwr!"


"You don't say so!" Milt answered in surprise. "Well, if I promised to take you, I'll keep my word." He vaulted out, tucked Vere de Vere into the seat, protecting her from the rain with the tarpaulin winter radiator-cover.

animalraincar part


His rut-skipping car overtook the mud-walloping Gomez-Dep in an hour, and pulled it out of the mud.

car modelpersonificationroad conditionaccidentmudspeed


Before Milt slept that night, in his camp three miles from Gopher Prairie, he went through religious rites.


"Girl like her, she's darn particular about her looks. I'm a sloppy hound. Used to be snappier about my clothes when I was in high school. Getting lazy—too much like Mac. Think of me sleeping in my clothes last night!"


"Mrwr!" rebuked the cat.


"You're dead right. Fierce is the word. Nev' will sleep in my duds again, puss. That is, when I have a reg'lar human bed. Course camping, different. But still—— Let's see all the funny things we can do to us."


He shaved—two complete shaves, from lather to towel. He brushed his hair. He sat down by a campfire sheltered between two rocks, and fought his nails, though they were discouragingly crammed with motor grease. Throughout this interesting but quite painful ceremony Milt kept up a conversation between himself as the World's Champion Dude, and his cat as Vallay. But when there was nothing more to do, and the fire was low, and Vere de Vere asleep in the sleeve of the winter ulster, his bumbling voice slackened; in something like agony he muttered:

car part


"But oh, what's the use? I can't ever be anything but a dub! Cleaning my nails, to make a hit with a girl that's got hands like hers! It's a long trail to Seattle, but it's a darn sight longer one to being—being—well, sophisticated. Oh! And incidentally, what the deuce am I going to do in Seattle if I do get there?"


Chapter VI


THE LAND OF BILLOWING CLOUDS (66-73)


Never a tawny-beached ocean has the sweetness of the prairie slew. Rippling and blue, with long grass up to its edge, a spot of dancing light set in the miles of rustling wheat, it retains even in July, on an afternoon of glare and brazen locusts, the freshness of a spring morning. A thousand slews, a hundred lakes bordered with rippling barley or tinkling bells of the flax, Claire passed. She had left the occasional groves of oak and poplar and silver birch, and come out on the treeless Great Plains.


She had learned to call the slews "pugholes," and to watch for ducks at twilight. She had learned that about the pugholes flutter choirs of crimson-winged blackbirds; that the ugly brown birds squatting on fence-rails were the divine-voiced meadow larks; that among the humble cowbird citizens of the pastures sometimes flaunted a scarlet tanager or an oriole; and that no rose garden has the quaint and hardy beauty of the Indian paint brushes and rag babies and orange milkweed in the prickly, burnt-over grass between roadside and railway line.

road conditionanimaltwilightlakesoundplantroad sidetrain


She had learned that what had seemed rudeness in garage men and hotel clerks was often a resentful reflection of her own Eastern attitude that she was necessarily superior to a race she had been trained to call "common people." If she spoke up frankly, they made her one of their own, and gave her companionable aid.

garageclass


For two days of sunshine and drying mud she followed a road flung straight across flat wheatlands, then curving among low hills. Often there were no fences; she was so intimately in among the grain that the fenders of the car brushed wheat stalks, and she became no stranger, but a part of all this vast-horizoned land. She forgot that she was driving, as she let the car creep on, while she was transported by Armadas of clouds, prairie clouds, wisps of vapor like a ribbed beach, or mounts of cumulus swelling to gold-washed snowy peaks.

sunshineroad conditioncar partsceneryskillcloudpleasuremountainpastoral


The friendliness of the bearing earth gave her a calm that took no heed of passing hours. Even her father, the abstracted man of affairs, nodded to dusty people along the road; to a jolly old man whose bulk rolled and shook in a tiny, rhythmically creaking buggy, to women in the small abrupt towns with their huge red elevators and their long, flat-roofed stores.

passengerpedestrianroad side


Claire had discovered America, and she felt stronger, and all her days were colored with the sun.

affectsunshine


She had discovered, too, that she could adventure. No longer was she haunted by the apprehension that had whispered to her as she had left Minneapolis. She knew a thrill when she hailed—as though it were a passing ship—an Illinois car across whose dust-caked back was a banner "Chicago to the Yellowstone." She experienced a new sensation of common humanness when, on a railway paralleling the wagon road for miles, the engineer of a freight waved his hand to her, and tooted the whistle in greeting.

traindrivingaffectcar


Her father was easily tired, but he drowsed through the early afternoons when a none-too-digestible small-town lunch was as lead within him. Despite the beauty of the land and the joy of pushing on, they both had things to endure.

affect


After lunch, it was sometimes an agony to Claire to keep awake. Her eyes felt greasy from the food, or smarted with the sun-glare. In the still air, after the morning breeze had been burnt out, the heat from the engine was a torment about her feet; and if there was another car ahead, the trail of dust sifted into her throat. Unless there was traffic to keep her awake, she nodded at the wheel; she was merely a part of a machine that ran on without seeming to make any impression on the prairie's endlessness.

car partengineroad conditiondusttastevisionanthropomorphism


Over and over there were the same manipulations: slow for down hill, careful of sand at the bottom, letting her out on a smooth stretch, waving to a lonely farmwife in her small, baked dooryard, slow to pass a hay-wagon, gas for up the next hill, and repeat the round all over again. But she was joyous till noon; and with mid-afternoon a new strength came which, as rose crept above the golden haze of dust, deepened into serene meditation.

slownessroad surfacedriveraffect


And she was finding the one secret of long-distance driving—namely, driving; keeping on, thinking by fifty-mile units, not by the ten-mile stretches of Long Island runs; and not fretting over anything whatever. She seemed charmed; if she had a puncture—why, she put on the spare. If she ran out of gas—why, any passing driver would lend her a gallon. Nothing, it seemed, could halt her level flight across the giant land.

driveraffectmetaphor


She rarely lost her way. She was guided by the friendly trail signs—those big red R's and L's on fence post and telephone pole, magically telling the way from the Mississippi to the Pacific.

mapnavigation


Her father's occasional musing talk kept her from loneliness. He was a good touring companion. Motoring is not the best occasion for epigrams, satire, and the Good One You Got Off at the Lambs' Club last night. Such verbiage on motor trips invariably results in the mysterious finding of the corpse of a strange man, well dressed, hidden beside the road. Claire and her father mumbled, "Good farmhouse—brick," or "Nice view," and smiled, and were for miles as silent as the companionable sky.

passenger


She thought of the people she knew, especially of Jeff Saxton. But she could not clearly remember his lean earnest face. Between her and Jeff were sweeping sunny leagues. But she was not lonely. Certainly she was not lonely for a young man with a raincoat, a cat, and an interest in Japan.


No singer after a first concert has felt more triumphant than Claire when she crossed her first state-line; rumbled over the bridge across the Red River into North Dakota. To see Dakota car licenses everywhere, instead of Minnesota, was like the sensation of street signs in a new language. And when she found a good hotel in Fargo and had a real bath, she felt that by her own efforts she had earned the right to enjoy it.

drivingaffectbridgerivercity


Mr. Boltwood caught her enthusiasm. Dinner was a festival, and in iced tea the peaceful conquistadores drank the toast of the new Spanish Main; and afterward, arm in arm, went chattering to the movies.

affectpioneer


In front of the Royal Palace, Pictures, 4 Great Acts Vaudeville 4, was browsing a small, beetle-like, tin-covered car.

car model


"Dad! Look! I'm sure—yes, of course, there's his suitcase—that's the car of that nice boy—don't you remember?—the one that pulled us out of the mud at—I don't remember the name of the place. Apparently he's keeping going. I remember; he's headed for Seattle, too. We'll look for him in the theater. Oh, the darling, there's his cat! What was the funny name he gave her—the Marchioness Montmorency or something?"


Lady Vere de Vere, afraid of Fargo and movie crowds, but trusting in her itinerant castle, the bug, was curled in Milt Daggett's ulster, in the bottom of the car. She twinkled her whiskers at Claire, and purred to a stroking hand.

animalmetaphor


With the excitement of one trying to find the address of a friend in a strange land Claire looked over the audience when the lights came on before the vaudeville. In the second row she saw Milt's stiffish, rope-colored mair—surprisingly smooth above an astoundingly clean new tan shirt of mercerized silk.


He laughed furiously at the dialogue between Pete-Rosenheim & Larose-Bettina, though it contained the cheese joke, the mother-in-law joke, and the joke about the wife rifling her husband's pockets.


"Our young friend seems to have enviable youthful spirits," commented Mr. Boltwood.


"Now, no superiority! He's probably never seen a real vaudeville show. Wouldn't it be fun to take him to the Winter Garden or the Follies for the first time!... Instead of being taken by Jeff Saxton, and having the humor, oh! so articulately explained!"


The pictures were resumed; the film which, under ten or twelve different titles, Claire had already seen, even though Brooklyn Heights does not devote Saturday evening to the movies. The badman, the sheriff—an aged party with whiskers and boots—the holdup, the sad eyes of the sheriff's daughter—also an aged party, but with a sunbonnet and the most expensive rouge—the crook's reformation, and his violent adherence to law and order; this libel upon the portions of these United States lying west of longitude 101° Claire had seen too often. She dragged her father back to the hotel, sent him to bed, and entered her room—to find a telegram upon the bureau.


She had sent her friends a list of the places at which she would be likely to stop. The message was from Jeff Saxton, in Brooklyn. It brought to her mind the steady shine of his glasses—the most expensive glasses, with the very best curved lenses—as it demanded:


"Received letter about trip surprised anxious will tire you out fatigue prairie roads bad for your father mountain roads dangerous strongly advise go only part way then take train. GEOFFREY."

trainroadrisk


She held the telegram, flipping her fingers against one end of it as she debated. She remembered how the wide world had flowed toward her over the hood of the Gomez all day. She wrote in answer:

car modelcar partmetaphor


"Awful perils of road, two punctures, split infinitive, eggs at lunch questionable, but struggle on."

road conditionrisk


Before she sent it she held council with her father. She sat on the foot of his bed and tried to sound dutiful. "I don't want to do anything that's bad for you, daddy. But isn't it taking your mind away from business?"


"Ye-es, I think it is. Anyway, we'll try it a few days more."


"I fancy we can stand up under the strain and perils. I think we can persuade some of these big farmers to come to the rescue if we encounter any walruses or crocodiles among the wheat. And I have a feeling that if we ever get stuck, our friend of the Teal bug will help us."

affectanimalriskcar model


"Probably never see him again. He'll skip on ahead of us."


"Of course. We haven't laid an eye on him, along the road. He must have gotten into Fargo long before we did. Now tomorrow I think——"


Chapter VII


THE GREAT AMERICAN FRYING PAN (74-84)


It was Claire's first bad day since the hole in the mud. She had started gallantly, scooting along the level road that flies straight west of Fargo. But at noon she encountered a restaurant which made eating seem an evil.

driverskillroad


That they might have fair fame among motorists the commercial club of Reaper had set at the edge of town a sign "Welcome to Reaper, a Live Town—Speed Limit 8 Miles perhr." Being interpreted, that sign meant that if you went much over twenty miles an hour on the main street, people might glance at you; and that the real welcome, the only impression of Reaper that tourists were likely to carry away, was the welcome in the one restaurant. It was called the Eats Garden. As Claire and her father entered, they were stifled by a belch of smoke from the frying pan in the kitchen. The room was blocked by a huge lunch counter; there was only one table, covered with oil cloth decorated with venerable spots of dried egg yolk.

traffic sign


The waiter-cook, whose apron was gravy-patterned, with a border and stomacher of plain gray dirt, grumbled, "Whadyuhwant?"


Claire sufficiently recovered to pick out the type from the fly specks on the menu, and she ordered a small steak and coffee for her father; for herself tea, boiled eggs, toast.


"Toast? We ain't got any toast!"


"Well, can't you make it?"


"Oh, I suppose I could——"


When they came, the slices of toast were an inch thick, burnt on one side and raw on the other. The tea was bitter and the eggs watery. Her father reported that his steak was high-test rawhide, and his coffee—well, he wasn't sure just what substitute had been used for chicory, but he thought it was lukewarm quinine.


Claire raged: "You know, this town really has aspirations. They're beginning to build such nice little bungalows, and there's a fine clean bank—— Then they permit this scoundrel to advertise the town among strangers, influential strangers, in motors, by serving food like this! I suppose they think that they arrest criminals here, yet this restaurant man is a thief, to charge real money for food like this—— Yes, and he's a murderer!"

class


"Oh, come now, dolly!"


"Yes he is, literally. He must in his glorious career have given chronic indigestion to thousands of people—shortened their lives by years. That's wholesale murder. If I were the authorities here, I'd be indulgent to the people who only murder one or two people, but imprison this cook for life. Really! I mean it!"


"Well, he probably does the best e——"


"He does not! These eggs and this bread were perfectly good, before he did black magic over them. And did you see the contemptuous look he gave me when I was so eccentric as to order toast? Oh, Reaper, Reaper, you desire a modern town, yet I wonder if you know how many thousands of tourists go from coast to coast, cursing you? If I could only hang that restaurant man—and the others like him—in a rope of his own hempen griddle cakes! The Great American Frying Pan! I don't expect men building a new town to have time to read Hugh Walpole and James Branch Cabell, but I do expect them to afford a cook who can fry eggs!"


As she paid the check, Claire tried to think of some protest which would have any effect on the obese wits of the restaurant man. In face of his pink puffiness she gave it up. Her failure as a Citizeness Fixit sent her out of the place in a fury, carried her on in a dusty whirl till the engine spat, sounded tired and reflective, and said it guessed it wouldn't go any farther that day.

affectdrivingenginepersonificationdust


Now that she had something to do, Claire became patient. "Run out of gas. Isn't it lucky I got that can for an extra gallon?"

maintenancegasoline


But there was plenty of gas. There was no discernible reason why the car should not go. She started the engine. It ran for half a minute and quit. All the plugs showed sparks. No wires were detached in the distributor. There was plenty of water, and the oil was not clogged. And that ended Claire's knowledge of the inside of a motor.

gasolineengineaccidentcar partoildriver


She stopped two motorists. The first was sure that there was dirt on the point of the needle valve, in the carburetor. While Claire shuddered lest he never get it back, he took out the needle valve, wiped it, put it back—and the engine was again started, and again, with great promptness, it stopped.

car part


The second Good Samaritan knew that one of the wires in the distributor must be detached and, though she assured him that she had inspected them, he looked pityingly at her smart sports-suit, said, "Well, I'll just take a look," and removed the distributor cover. He also scratched his head, felt of the fuses under the cowl, scratched his cheek, poked a finger at the carburetor, rubbed his ear, said, "Well, uh——" looked to see if there was water and gas, sighed, "Can't just seem to find out what's the trouble," shot at his own car, and escaped.

car partmaintenancegender


Claire had been highly grateful and laudatory to both of them—but she remained here, ten miles from nowhere. It was a beautiful place. Down a hill the wheat swam toward a village whose elevator was a glistening tower. Mud-hens gabbled in a slew, alfalfa shone with unearthly green, and bees went junketing toward a field of red clover. But she had the motorist's fever to go on. The road behind and in front was very long, very white—and very empty.

affectpastoralmetaphorroad


Her father, out of much thought and a solid ignorance about all of motoring beyond the hiring of chauffeurs and the payment of bills,
suggested, "Uh, dolly, have you looked to see if these, uh—— Is the carburetor all right?"

classdrivercar part


"Yes, dear; I've looked at it three times, so far," she said, just a little too smoothly.


On the hill five miles to eastward, a line of dust, then a small car. As it approached, the driver must have sighted her and increased speed. He came up at thirty-five miles an hour.

cardustdriverspeed


"Now we'll get something done! Look! It's a bug—a flivver or a Teal or something. I believe it's the young man that got us out of the mud."

car model


Milt Daggett stopped, casually greeted them: "Why, hello, Miss Boltwood. Thought you'd be way ahead of me some place!"


"Mrwr," said Vere de Vere. What this meant the historian does not know.


"No; I've been taking it easy. Mr., Uh—I can't quite remember your name——"


"Milt Daggett."


"There's something mysterious the matter with my car. The engine will start, after it's left alone a while, but then it stalls. Do you suppose you could tell what it is?"

engine


"I don't know. I'll see if I can find out."


"Then you probably will. The other two men knew everything. One of them was the inventor of wheels, and the other discovered skidding. So of course they couldn't help me."

car part


Milt added nothing to her frivolity, but his smile was friendly. He lifted the round rubber cap of the distributor. Then Claire's faith tumbled in the dust. Twice had the wires been tested. Milt tested them again. She was too tired of botching to tell him he was wasting time.

car partmaintenance


"Got an oil can?" he hesitated.

oil


Through a tiny hole in the plate of the distributor he dripped two drops of oil—only two drops. "I guess maybe that's what it needed. You might try her now, and see how she runs," he said mildly.

maintenanceoilpersonification


Dubiously Claire started the engine. It sang jubilantly, and it did not stop. Again was the road open to her. Again was the settlement over there, to which it would have taken her an hour to walk, only six minutes away.

enginepioneer


She stopped the engine, beamed at him—there in the dust, on the quiet hilltop. He said as apologetically as though he had been at fault, "Distributor got dry. Might give it a little oil about once in six months."

enginecar partoilmaintenance


"We are so grateful to you! Twice now you've saved our lives."


"Oh, I guess you'd have gone on living! And if drivers can't help each other, who can?"

driver


"That's a good start toward world-fellowship, I suppose. I wish we could do—— Return your lunch or—— Mr. Daggett! Do you read books? I mean——"


"Yes I do, when I run across them."


"Mayn't I gi—lend you these two that I happen to have along? I've finished them, and so has father, I think."


From the folds of the strapped-down top she pulled out Compton Mackenzie's Youth's Encounter, and Vachel Lindsay's Congo. With a curious faint excitement she watched him turn the leaves. His blunt fingers flapped through them as though he was used to books. As he looked at Congo, he exclaimed, "Poetry! That's fine! Like it, but I don't hardly ever run across it. I—— Say—— I'm terribly obliged!"

car part


His clear face lifted, sun-brown and young and adoring. She had not often seen men look at her thus. Certainly Jeff Saxton's painless
worship did not turn him into the likeness of a knight among banners. Yet the good Geoffrey loved her, while to Milt Daggett she could be nothing more than a strange young woman in a car with a New York license. If her tiny gift could so please him, how poor he must be. "He probably lives on some barren farm," she thought, "or he's a penniless mechanic hoping for a good job in Seattle. How white his forehead is!"


But aloud she was saying, "I hope you're enjoying your trip."


"Oh yes. I like it fine. You having a good time? Well—— Well, thanks for the books."


She was off before him. Presently she exclaimed to Mr. Boltwood: "You know—just occurs to me—it's rather curious that our young friend should be so coincidental as to come along just when we needed him."


"Oh, he just happened to, I suppose," hemmed her father.


"I'm not so sure," she meditated, while she absently watched another member of the Poultry Suicide Club rush out of a safe ditch, prepare to take leave for immortality, change her fowlish mind, flutter up over the hood of the car, and come down squawking her indignities to the barnyard. "I'm not so sure about his happening—— No. I wonder if he could possibly—— Oh no. I hope not. Flattering, but—— You don't suppose he could be deliberately following us?"

animalroadkillcar part


"Nonsense! He's a perfectly decent young chap."


"I know. Of course. He probably works hard in a garage, and is terribly nice to his mother and sisters at home. I mean—— I wouldn't want the dear lamb to be a devoted knight, though. Too thankless a job."

garage


She slowed the car down to fifteen an hour. For the first time she began to watch the road behind her. In a few minutes a moving spot showed in the dust three miles back. Oh, naturally; he would still be behind her. Only—— If she stopped, just to look at the scenery, he would go on ahead of her. She stopped for a moment—for a time too brief to indicate that anything had gone wrong with her car. Staring back she saw that the bug stopped also, and she fancied that Milt was out standing beside it, peering with his palm over his eyes—a spy, unnatural and disturbing in the wide peace.

roadcar model


She drove on a mile and halted again; again halted her attendant. He was keeping a consistent two to four miles behind, she estimated.


"This won't do at all," she worried. "Flattering, but somehow—— Whatever sort of a cocoon-wrapped hussy I am, I don't collect scalps. I won't have young men serving me—graft on them—get amusement out of their struggles. Besides—suppose he became just a little more friendly, each time he came up, all the way from here to Seattle?... Fresh.... No, it won't do."


She ran the car to the side of the road.

road side


"More trouble?" groaned her father.


"No. Just want to see scenery."


"But—— There's a good deal of scenery on all sides, without stopping, seems to me!"


"Yes, but——" She looked back. Milt had come into sight; had paused to take observations. Her father caught it:


"Oh, I see. Pardon me. Our squire still following? Let him go on ahead? Wise lass."


"Yes. I think perhaps it's better to avoid complications."


"Of course." Mr. Boltwood's manner did not merely avoid Milt; it abolished him.


She saw Milt, after five minutes of stationary watching, start forward. He came dustily rattling up with a hail of "Distributor on strike again?" so cheerful that it hurt her to dismiss him. But she had managed a household. She was able to say suavely:

drivingsoundcar part


"No, everything is fine. I'm sure it will be, now. I'm afraid we are holding you back. You mustn't worry about us."


"Oh, that's all right," breezily. "Something might go wrong. Say, is this poetry book——"


"No, I'm sure nothing will go wrong now. You mustn't feel responsible for us. But, uh, you understand we're very grateful for what you have done and, uh, perhaps we shall see each other in Seattle?" She made it brightly interrogatory.


"Oh, I see." His hands gripped the wheel. His cheeks had been too ruddily tinted by the Dakota sun to show a blush, but his teeth caught his lower lip. He had no starter on his bug; he had in his embarrassment to get out and crank. He did it quietly, not looking at her. She could see that his hand trembled on the crank. When he did glance at her, as he drove off, it was apologetically, miserably. His foot was shaking on the clutch pedal.

car partcar modelhaptic


The dust behind his car concealed him. For twenty miles she was silent, save when she burst out to her father, "I do hope you're enjoying the trip. It's so easy to make people unhappy. I wonder—— No. Had to be done."

dust


Chapter VIII


THE DISCOVERY OF CANNED SHRIMPS AND HESPERIDES (85-100)


On the morning when Milt Daggett had awakened to sunshine in the woods north of Gopher Prairie, he had discovered the golden age. As mile on mile he jogged over new hills, without having to worry about getting back to his garage in time to repair somebody's car, he realized that for the past two years he had forced himself to find contentment in building up a business that had no future.

garage


Now he laughed and whooped; he drove with one foot inelegantly and enchantingly up on the edge of the cowl; he made Lady Vere de Vere bow to astounded farmers; he went to the movies every evening—twice, in Fargo; and when the chariot of the young prince swept to the brow of a hill, he murmured, not in the manner of a bug-driver but with a stinging awe, "All that big country! Ours to see, puss! We'll settle down some day and be solid citizens and raise families and wheeze when we walk, but—— All those hills to sail over and—— Come on! Lez sail!"

drivingpleasurecar partmetaphorcar modeldriver


Milt attended the motion pictures every evening, and he saw them in a new way. As recently as one week before he had preferred those earnest depictions in which hard-working, moral actors shoot one another, or ride the most uncomfortable horses up mountainsides. But now, with a mental apology to that propagandist of lowbrowism, the absent Mac, he chose the films in which the leading men wore evening clothes, and no one ever did anything without being assisted by a "man." Aside from the pictures Milt's best tutors were traveling men. Though he measured every cent, and for his campfire dinners bought modest chuck steaks, he had at least one meal a day at a hotel, to watch the traveling men.


To Claire, traveling men were merely commercial persons in hard-boiled suits. She identified them with the writing-up of order-slips on long littered writing-tables, and with hotels that reduced the delicate arts of dining and sleeping to gray greasiness. But Milt knew traveling men. He knew that not only were they the missionaries of business, supplementing the taking of orders by telling merchants how to build up trade, how to trim windows and treat customers like human beings; but also that they, as much as the local ministers and doctors and teachers and newspapermen, were the agents in spreading knowledge and justice. It was they who showed the young men how to have their hair cut—and to wash behind the ears and shave daily; they who encouraged villagers to rise from scandal and gossip to a perception of the Great World, of politics and sports, and some measure of art and science.


Claire, and indeed her father and Mr. Jeff Saxton as well, had vaguely concluded that because drummers were always to be seen in soggy hotels and badly connecting trains and the headachy waiting-rooms of stations, they must like these places. Milt knew that the drummers were martyrs; that for months of a trip, all the while thinking of the children back home, they suffered from landlords and train schedules; that they were Claire's best allies in fighting the Great American Frying Pan; that they knew good things, and fought against the laziness and impositions of people who "kept hotel" because they had failed as farmers; and that when they did find a landlord who was cordial and efficient, they went forth mightily advertising that glorious man. The traveling men, he knew, were pioneers in spats.


Hence it was to the traveling men, not to supercilious tourists in limousines, that Milt turned for suggestions as to how to perform the miracle of changing from an ambitious boy into what Claire would recognize as a charming man. He had not met enough traveling men at Schoenstrom. They scooped up what little business there was, and escaped from the Leipzig House to spend the night at St. Cloud or Sauk Centre.

car modelclass


In the larger towns in Minnesota and Dakota, after evening movies, before slipping out to his roadside camp Milt inserted himself into a circle of traveling men in large leather chairs, and ventured, "Saw a Gomez-Dep with a New York license down the line today."

road sidecar model


"Oh. You driving through?"


"Yes. Going to Seattle."


That distinguished Milt from the ordinary young-men-loafers, and he was admitted as one of the assembly of men who traveled and saw things and wondered about the ways of men. It was good talk he heard; too much of hotels, and too many tight banal little phrases suggesting the solution of all economic complexities by hanging "agitators," but with this, an exciting accumulation of impressions of Vancouver and San Diego, Florida and K. C.


"That's a wonderful work farm they have at Duluth," said one, and the next, "speaking of that, I was in Chicago last week, and I saw a play——"


Milt had, in his two years of high school in St. Cloud, and in his boyhood under the genial but abstracted eye of the Old Doctor, learned that it was not well thought of to use the knife as a hod and to plaster mashed potatoes upon it, as was the custom in Mac's Old Home Lunch at Schoenstrom. But the arts of courteously approaching oysters, salad, and peas were rather unfamiliar to him. Now he studied forks as he had once studied carburetors, and he gave spiritual devotion to the nice eating of a canned-shrimp cocktail—a lost legion of shrimps, now two thousand miles and two years away from their ocean home.


He peeped with equal earnestness at the socks and the shirts of the traveling men. Socks had been to him not an article of faith but a detail of economy. His attitude to socks had lacked in reverence and technique. He had not perceived that socks may be as sound a symbol of culture as the 'cello or even demountable rims. He had been able to think with respect of ties and damp piqué collars secured by gold safety-pins; and to the belted fawn overcoat that the St. Klopstock banker's son had brought back from St. Paul, he had given jealous attention. But now he graduated into differential socks.

car partclass


By his campfire, sighing to the rather somnolent Vere de Vere, he scornfully yanked his extra pairs of thick, white-streaked, yellow cotton socks from the wicker suitcase, and uttered anathema:


"Begone, ye unworthy and punk-looking raiment. I know ye! Ye werst a bargain and two pairs for two bits. But even as Adolph Zolzac and an agent for flivver accessories are ye become in my eyes, ye generation of vipers, ye clumsy, bag-footed, wrinkle-sided gunny-sacking ye!"

car model


Next day, in the woods, a happy hobo found that the manna-bringing ravens had left him four pairs of good socks.


Five quite expensive pairs of silk and lisle socks Milt purchased—all that the general merchant at Jeppe had in stock. What they lost in suitability to touring and to private laundering at creeks, they gained as symbols. Milt felt less shut out from the life of leisure. Now, in Seattle, say, he could go into a good hotel with less fear of the clerks.


He added attractive outing shirts, ties neither too blackly dull nor too flashily crimson, and a vicious nail-brush which simply tore out the motor grease that had grown into the lines of his hands. Also he added a book.

car part


The book was a rhetoric. Milt knew perfectly that there was an impertinence called grammar, but it had never annoyed him much. He knew that many persons preferred "They were" to "They was," and were nervous in the presence of "ain't." One teacher in St. Cloud had buzzed frightfully about these minutiæ. But Milt discovered that grammar was only the beginning of woes. He learned that there were such mental mortgages as figures of speech and the choice of synonyms. He had always known, but he had never passionately felt that the invariable use of "hell," "doggone," and "You bet!" left certain subtleties unexpressed. Now he was finding subtleties which he had to express.


As joyously adventurous as going on day after day was his experimentation in voicing his new observations. He gave far more eagerness to it than Claire Boltwood had. Gustily intoning to Vere de Vere, who was the perfect audience, inasmuch as she never had anything to say but "Mrwr," and didn't mind being interrupted in that, he clamored, "The prairies are the sea. In the distance they are kind of silvery—no—they are dim silver; and way off on the skyline are the Islands of the—of the—— Now what the devil was them, were those, islands in the mythology book in high school? Of the—Blessed? Great snakes' boots, you're an ignorant cat, Vere! Hesperyds? No! Hesperides! Yea, bo'! Now that man in the hotel: 'May I trouble you for the train guide? Thanks so much!' But how much is so much?"


As Claire's days were set free by her consciousness of sun and brown earth, so Milt's odyssey was only the more valorous in his endeavor to criticize life. He saw that Mac's lunch room had not been an altogether satisfactory home; that Mac's habit of saying to dissatisfied customers, "If you don't like it, get out," had lacked something of courtesy. Staring at towns along the way, Milt saw that houses were not merely large and comfortable, or small and stingy; but that there was an interesting thing he remembered hearing his teachers call "good taste."


He was not the preoccupied Milt of the garage but a gay-eyed gallant, the evening when he gave a lift to the school-teacher and drove her from the district school among the wild roses and the corn to her home in the next town. She was a neat, tripping, trim-sided school-teacher of nineteen or twenty.

garagepassenger


"You're going out to Seattle? My! That's a wonderful trip. Don't you get tired?" she adored.


"Oh, no. And I'm seeing things. I used to think everything worth while was right near my own town."


"You're so wise to go places. Most of the boys I know don't think there is any world beyond Jimtown and Fargo."


She glowed at him. Milt was saying to himself, "Am I a fool? I probably could make this girl fall in love with me. And she's better than I am; so darn neat and clean and gentle. We'd be happy. She's a nice comfy fire, and here I go like a boob, chasing after a lone, cold star like Miss Boltwood, and probably I'll fall into all the slews from hell to breakfast on the way. But—— I'd get sleepy by a comfy fire."


"Are you thinking hard? You're frowning so," ventured the
school-teacher.


"Didn't mean to. 'Scuse!" he laughed. One hand off the steering wheel, he took her hand—a fresh, cool, virginal hand, snuggling into his, suddenly stirring him. He wanted to hold it tighter. The lamenting historian of love's pilgrimage must set down the fact that the pilgrim for at least a second forgot the divine tread of the goddess Claire, and made rapid calculation that he could, in a pinch, drive from Schoenstrom to the teacher's town in two days and a night; that therefore courtship, and this sweet white hand resting in his, were not impossible. Milt himself did not know what it was that made him lay down the hand and say, so softly that he was but half audible through the rattle of the engine:

car partenginesoundpioneer


"Isn't this a slick, mean to say glorious evening? Sky rose and then that funny lavender. And that new moon—— Makes me think of—the girl I'm in love with."


"You're engaged?" wistfully.


"Not exactly but—— Say, did you study rhetoric in Normal School? I have a rhetoric that's got all kind of poetic extracts, you know, and quotations and everything, from the big writers, Stevenson and all. Always been so practical, making a garage pay, never thought much about how I said things as long as I could say 'No!' and say it quick. 'Cept maybe when I was talking to the prof there. But it's great sport to see how musical you can make a thing sound. Words. Like Shenandoah. Gol-lee! Isn't that a wonderful word? Makes you see old white mansion, and mocking birds—— Wonder if a fellow could be a big engineer, you know, build bridges and so on, and still talk about, oh, beautiful things? What d' you think, girlie?"

garage


"Oh, I'm sure you could!"


Her admiration, the proximity of her fragrant slightness, was pleasant in the dusk, but he did not press her hand again, even when she whispered, "Good night, and thank you—oh, thank you."


If Milt had been driving at the rate at which he usually made his skipjack carom over the roads about Schoenstrom, he would by now have been through Dakota, into Montana. But he was deliberately holding down the speed. When he had been tempted by a smooth stretch to go too breathlessly, he halted, teased Vere de Vere, climbed out and, sitting on a hilltop, his hands about his knees, drenched his soul with the vision of amber distances.

speedroadmetaphor


He tried so to time his progress that he might always be from three to five miles behind Claire—distant enough to be unnoticed, near enough to help in case of need. For behind poetic expression and the use of forks was the fact that his purpose in life was to know Claire.


When he was caught, when Claire informed him that he "mustn't worry about her"; when, slowly, he understood that she wasn't being neighborly and interested in his making time, he wanted to escape, never to see her again.


For thirty miles his cheeks were fiery. He, most considerate of roadmen, crowded a woman in a flivver, passed a laboring car on an upgrade with such a burst that the uneasy driver bumped off into a ditch. He hadn't really seen them. Only mechanically had he got past them. He was muttering:

drivercar model


"She thought I was trying to butt in! Stung again! Like a small boy in love with teacher. And I thought I was so wise! Cussed out Mac—blamed Mac—no, damn all the fine words—cussed out Mac for being the village rumhound. Boozing is twice as sensible as me. See a girl, nice dress—start for Seattle! Two thousand miles away! Of course she bawled me out. She was dead right. Boob! Yahoo! Goat!"


He caught up Vere de Vere, rubbed her fur against his cheek while he mourned, "Oh, puss, you got to be nice to me. I thought I'd do big things. And then the alarm clock went off. I'm back in Schoenstrom. For keeps, I guess. I didn't know I had feelings that could get hurt like this. Thought I had a rhinoceros hide. But—— Oh, it isn't just feeling ashamed over being a fool. It's that—— Won't ever see her again. Not once. Way I saw her through the window, at that hotel, in that blue silky dress—that funny long line of buttons, and her throat. Never have dinner—lunch—with her by the road——"

road side


In the reaction of anger he demanded of Vere de Vere, "What the deuce do I care? If she's chump enough to chase away a crack garage man that's gone batty and wants to work for nothing, let her go on and hit some crook garage and get stuck for an entire overhauling. What do I care? Had nice trip; that's all I wanted. Never did intend to go clear to Seattle, anyway. Go on to Butte, then back home. No more fussing about fool table-manners and books, and I certainly will cut out tagging behind her! No, sir! Nev-er again!"

garagemaintenance


It was somewhat inconsistent to add, "There's a bully place—sneak in and let her get past me again. But she won't catch me following next time!"


While he tried to keep up his virtuous anger, he was steering into an abandoned farmyard, parking the car behind cottonwoods and neglected tall currant bushes which would conceal it from the road.

parkingplant


The windows of the deserted house stared at him; a splintered screen door banged in every breeze. Lichens leered from the cracks of the porch. The yard was filled with a litter of cottonwood twigs, and over the flower garden hulked ragged weeds. In the rank grass about the slimy green lip of the well, crickets piped derisively. The barn-door was open. Stray kernels of wheat had sprouted between the spokes of a rusty binder-wheel. A rat slipped across the edge of the shattered manger. As dusk came on, gray things seemed to slither past the upper windows of the house, and somewhere, under the roof, there was a moaning. Milt was sure that it was the wind in a knothole. He told himself that he was absolutely sure about it. And every time it came he stroked Vere de Vere carefully, and once, when the moaning ended in the slamming of the screen door, he said, "Jiminy!"

affectsoundplantvisibility


This boy of the unghostly cylinders and tangible magnetos had never seen a haunted house. To toil of the harvest field and machine shop and to trudging the sun-beaten road he was accustomed, but he had never crouched watching the slinking spirits of old hopes and broken aspirations; feeble phantoms of the first eager bridegroom who had come to this place, and the mortgage-crushed, rust-wheat-ruined man who had left it. He wanted to leap into the bug and go on. Yet the haunt of murmurous memories dignified his unhappiness. In the soft, tree-dimmed dooryard among dry, blazing plains it seemed indecent to go on growling "Gee," and "Can you beat it?" It was a young poet, a poet rhymeless and inarticulate, who huddled behind the shield of untrimmed currant bushes, and thought of the girl he would never see again.

car model


He was hungry, but he did not eat. He was cramped, but he did not move. He picked up the books she had given him. He was quickened by the powdery beauty of Youth's Encounter; by the vision of laughter and dancing steps beneath a streaky gas-glow in the London fog; of youth not "roughhousing" and wanting to "be a sport," yet in frail beauty and faded crimson banners finding such exaltation as Schoenstrom had never known. But every page suggested Claire, and he tucked the book away.


In Vachel Lindsay's Congo, in a poem called "The Santa Fe Trail," he found his own modern pilgrimage from another point of view. Here was the poet, disturbed by the honking hustle of passing cars. But Milt belonged to the honking and the hustle, and it was not the soul of the grass that he read in the poem, but his own sun-flickering flight:

religionpioneersound


    Swiftly the brazen car comes on.
    It burns in the East as the sunrise burns.
    I see great flashes where the far trail turns.
    Butting through the delicate mists of the morning,
    It comes like lightning, goes past roaring,
    It will hail all the windmills, taunting, ringing,
    On through the ranges the prairie-dog tills—
    Scooting past the cattle on the thousand hills.
    Ho for the tear-horn, scare-horn, dare-horn,
    Ho for the gay-horn, bark-horn, bay-horn.

intertextcarspeedroadfogsoundanimalscenerymountainpersonification


Milt did not reflect that if the poet had watched the Teal bug go by, he would not have recorded a scare-horn, a dare-horn, or anything mightier than a yip-horn. Milt saw himself a cross-continent racer, with the envious poet, left behind as a dot on the hill, celebrating his passing.

car modeldriver


"Lord!" he cried. "I didn't know there were books like these! Thought poetry was all like Longfellow and Byron. Old boys. Europe. And rhymed bellyachin' about hard luck. But these books—they're me." Very carefully: "No; they're I! And she gave 'em to me! I will see her again! But she won't know it. Now be sensible, son! What do you expect? Oh—nothing. I'll just go on, and sneak in one more glimpse of her to take back with me where I belong."


Half an hour after Claire had innocently passed his ambush, he began to follow her. But not for days was he careless. If he saw her on the horizon he paused until she was out of sight. That he might not fail her in need, he bought a ridiculously expensive pair of field glasses, and watched her when she stopped by the road. Once, when both her right rear tire and the spare were punctured before she could make a town, Milt from afar saw her patch a tube, pump up the tire in the dust. He ached to go to her aid—though it cannot be said that hand-pumping was his favorite July afternoon sport.

car partaccidentroad sidemaintenance


Lest he encounter her in the streets, he always camped to the eastward of the town at which she spent the night. After dusk, when she was likely to end the day's drive in the first sizable place, he hid his bug in an alley and, like a spy after the papers, sneaked into each garage to see if her car was there.

car modelgarage


He would stroll in, look about vacuously, and pipe to the suspicious night attendant, "Seen a traveling man named Smith?" Usually the garage man snarled, "No, I ain't seen nobody named Smith. An'thing else I can do for you?" But once he was so unlucky as to find the long-missing Mr. Smith!


Mr. Smith was surprised and insistent. Milt had to do some quick lying. During that interview the cement floor felt very hard under his fidgeting feet, and he thought he heard the garage man in the office telephoning, "Don't think he knows Smith at all. I got a hunch he's that auto thief that was through here last summer."


When Claire did not stop in the first town she reached after twilight, but drove on by dark, he had to do some perilous galloping to catch up. The lights of a Teal are excellent for adornment, but they have no relation to illumination. They are dependent upon a magneto which is dependent only upon faith.

twilightdrivingnightriskmetaphorcar modelcar partvision


Once, skittering along by dark, he realized that the halted car which he had just passed was the Gomez. He thought he heard a shout behind him, but in a panic he kept going.

nightcar model


To the burring motor he groaned, "Now I probably never will see her again. Except that she thinks I'm such a pest that I dassn't let her know I'm in the same state, I sure am one successful lover. As a Prince Charming I win the Vanderbilt Cup. I'm going ahead backwards so fast I'll probably drop off into the Atlantic over the next hill!"

soundcar


Chapter IX


THE MAN WITH AGATE EYES (101-111)


When her car had crossed the Missouri River on the swing-ferry between Bismarck and Mandan, Claire had passed from Middle West to Far West. She came out on an upland of virgin prairie, so treeless and houseless, so divinely dipping, so rough of grass, that she could imagine buffaloes still roving. In a hollow a real prairie schooner was camped, and the wandering homestead-seekers were cooking dinner beside it. From a quilt on the hay in the wagon a baby peeped, and Claire's heart leaped.

sceneryriverWest


Beyond was her first butte, its sharp-cut sides glittering yellow, and she fancied that on it the Sioux scout still sat sentinel, erect on his pony, the feather bonnet down his back.

mountain


Now she seemed to breathe deeper, see farther. Again she came from unbroken prairie into wheat country and large towns.


Her impression of the new land was not merely of sun-glaring breadth. Sometimes, on a cloudy day, the wash of wheatlands was as brown and lowering and mysterious as an English moor in the mist. It dwarfed the far-off houses by its giant enchantment; its brooding reaches changed her attitude of brisk, gas-driven efficiency into a melancholy that was full of hints of old dark beauty.


Even when the sun came out, and the land was brazenly optimistic, she saw more than just prosperity. In a new home, house and barn and windmill square-cornered and prosaic, plumped down in a field with wheat coming up to the unporticoed door, a habitation unshadowed, unsheltered, unsoftened, she found a frank cleanness, as though the inhabitants looked squarely out at life, unafraid. She felt that the keen winds ought to blow away from such a prairie-fronting post of civilization all mildew and cowardice, all the mummy dust of ancient fears.


These were not peasants, these farmers. Nor, she learned, were they the "hicks" of humor. She could never again encounter without fiery
resentment the Broadway peddler's faith that farmers invariably say "Waal, by heck." For she had spent an hour talking to one Dakota farmer, genial-eyed, quiet of speech. He had explained the relation of alfalfa to soil-chemistry; had spoken of his daughter, who taught economics in a state university; and asked Mr. Boltwood how turbines were hitched up on liners.


In fact, Claire learned that there may be an almost tolerable state of existence without gardenias or the news about the latest Parisian imagists.


She dropped suddenly from the vast, smooth-swelling miles of wheatland into the tortured marvels of the Bad Lands, and the road twisted in the shadow of flying buttresses and the terraced tombs of maharajas. While she tried to pick her way through a herd of wild, arroyo-bred cattle, she forgot her maneuvering as she was startled by the stabbing scarlet of a column of rock marking the place where for months deep beds of lignite had burned.

roadanimal


Claire had often given lifts to tramping harvesters and even hoboes along the road; had enjoyed the sight of their duffle-bags stuck up between the sleek fenders and the hood, and their talk about people and crops along the road, as they hung on the running-board. In the country of long hillslopes and sentinel buttes between the Dakota Bad Lands and Miles City she stopped to shout to a man whose plodding heavy back looked fagged, "Want a ride?"

hitchhikercar part


"Sure! You bet!"


Usually her guests stepped on the right-hand running-board, beside Mr. Boltwood, and this man was far over on the right side of the road. But, while she waited, he sauntered in front of the car, round to her side, mounted beside her. Before the car had started, she was sorry to have invited him. He looked her over grinningly, almost contemptuously. His unabashed eyes were as bright and hard as agates. Below them, his nose was twisted a little, his mouth bent insolently up at one corner, and his square long chin bristled.

hitchhikercar partroad side


Usually, too, her passengers waited for her to start the conversation, and talked at Mr. Boltwood rather than directly to her. But the bristly man spat at her as the car started, "Going far?"

drivergender


"Ye-es, some distance."


"Expensive car?"

car


"Why——"


"'Fraid of getting held up?"


"I hadn't thought about it."


"Pack a cannon, don't you?"


"I don't think I quite understand."


"Cannon! Gun! Revolver! Got a revolver, of course?"


"W-why, no." She spoke uncomfortably. She was aware that his twinkling eyes were on her throat. His look made her feel unclean. She tried to think of some question which would lead the conversation to the less exclamatory subject of crops. They were on a curving shelf road beside a shallow valley. The road was one side of a horseshoe ten miles long. The unprotected edge of it dropped sharply to fields forty or fifty feet below.

roadmountainrisk


"Prosperous-looking wheat down there," she said.


"No. Not a bit!" His look seemed to add, "And you know it—unless you're a fool!"


"Well, I didn't——"


"Make Glendive tonight?"


"At least that far."


"Say, lady, how's the chance for borrowin' a couple of dollars? I was workin' for a Finnski back here a ways, and he did me dirt—holdin' out my wages on me till the end of the month."


"Why, uh——"


It was Claire, not the man, who was embarrassed.


He was snickering, "Come on, don't be a tightwad. Swell car—poor man with no eats, not even a two-bits flop for tonight. Could yuh loosen up and slip me just a couple bones?"

carclass


Mr. Boltwood intervened. He looked as uncomfortable as Claire. "We'll see. It's rather against my principles to give money to an able-bodied man like you, even though it is a pleasure to give you a ride——"


"Sure! Don't cost you one red cent!"


"—and if I could help you get a job, though of course—— Being a
stranger out here—— Seems strange to me, though," Mr. Boltwood
struggled on, "that a strong fellow like you should be utterly destitute, when I see all these farmers able to have cars——"

class


Their guest instantly abandoned his attitude of supplication for one of boasting: "Destitute? Who the hell said I was destitute, heh?" He was snarling across Claire at Mr. Boltwood. His wet face was five inches from hers. She drew her head as far back as she could. She was sure that the man completely appreciated her distaste, for his eyes popped with amusement before he roared on:


"I got plenty of money! Just 'cause I'm hoofin' it—— I don't want no charity from nobody! I could buy out half these Honyockers! I don't need none of no man's money!" He was efficiently working himself into a rage. "Who you calling destitute? All I wanted was an advance till pay day! Got a check coming. You high-tone, kid-glove Eastern towerists want to watch out who you go calling destitute. I bet I make a lot more money than a lot of your four-flushin' friends!"


Claire wondered if she couldn't stop the car now, and tell him to get off. But—that snapping eye was too vicious. Before he got off he would say things—scarring, vile things, that would never heal in her brain. Her father was murmuring, "Let's drop him," but she softly lied, "No. His impertinence amuses me."

riskhitchhiker


She drove on, and prayed that he would of himself leave his uncharitable hosts at the next town.

drivingaffect


The man was storming—with a very meek ending: "I'm tellin' you! I can make money anywhere! I'm a crack machinist.... Give me two-bits for a meal, anyway."


Mr. Boltwood reached in his change pocket. He had no quarter. He pulled out a plump bill-fold. Without looking at the man, Claire could vision his eyes glistening and his chops dripping as he stared at the hoard. Mr. Boltwood handed him a dollar bill. "There, take that, and let's change the subject," said Mr. Boltwood testily.


"All right, boss. Say, you haven't got a cartwheel instead of this wrapping paper, have you? I like to feel my money in my pocket."


"No, sir, I have not!"


"All right, boss. No bad feelin's!"


Then he ignored Mr. Boltwood. His eyes focused on Claire's face. To steady himself on the running-board he had placed his left hand on the side of the car, his right on the back of the seat. That right hand slid behind her. She could feel its warmth on her back.

car part


She burst out, flaring, "Kindly do not touch me!"


"Gee, did I touch you, girlie? Why, that's a shame!" he drawled, his cracked broad lips turning up in a grin.


An instant later, as they skipped round a bend of the long, high-hung shelf road, he pretended to sway dangerously on the running-board, and deliberately laid his filthy hand on her shoulder. Before she could say anything he yelped in mock-regret, "Love o' Mike! 'Scuse me, lady. I almost fell off."

roadcar part


Quietly, seriously, Claire said, "No, that wasn't accidental. If you touch me again, I'll stop the car and ask you to walk."

drivergender


"Better do it now, dolly!" snapped Mr. Boltwood.


The man hooked his left arm about the side-post of the open window-shield. It was a strong arm, a firm grip. He seized her left wrist with his free hand. Though all the while his eyes grotesquely kept their amused sparkle, and beside them writhed laughter-wrinkles, he shouted hoarsely, "You'll stop hell!" His hand slid from her wrist to the steering wheel. "I can drive this boat's well as you can. You make one move to stop, and I steer her over—— Blooie! Down the bank!"

car partmetaphorriskhitchhikerdriver


He did twist the front wheels dangerously near to the outer edge of the shelf road. Mr. Boltwood gazed at the hand on the wheel. With a quick breath Claire looked at the side of the road. If the car ran off, it would shoot down forty feet ... turning over and over.

car partroad siderisk


"Y-you wouldn't dare, because you'd g-go, too!" she panted.


"Well, dearuh, you just try any monkey business and you'll find out how much I'll gggggggo-too! I'll start you down the joy-slope and jump off, savvy? Take your foot off that clutch."

car part


She obeyed.


"Pretty lil feet, ain't they, cutie! Shoes cost about twelve bucks, I reckon. While a better man than you or old moldy-face there has to hit the pike in three-dollar brogans. Sit down, yuh fool!"

car partclass


This last to Mr. Boltwood, who had stood up, swaying with the car, and struck at him. With a huge arm the man swept Mr. Boltwood back into the seat, but without a word to her father, he continued to Claire:


"And keep your hand where it belongs. Don't go trying to touch that switch. Aw, be sensible! What would you do if the car did stop? I could blackjack you both before this swell-elegant vehickle lost momentum, savvy? I don't want to pay out my good money to a lawyer on a charge of—murder. Get me? Better take it easy and not worry." His hand was constantly on the wheel. He had driven cars before. He was steering as much as she. "When I get you up the road a piece I'm going to drive all the cute lil boys and girls up a side trail, and take all of papa's gosh-what-a-wad in the cunnin' potet-book, and I guess we'll kiss lil daughter, and drive on, a-wavin' our hand politely, and let you suckers walk to the next burg."

car partriskcardriverskill


"You wouldn't dare! You wouldn't dare!"


"Dare? Huh! Don't make the driver laugh!"


"I'll get help!"


"Yep. Sure. Fact, there's a car comin' toward us. 'Bout a mile away I'd make it, wouldn't you? Well, dollface, if you make one peep—over the bank you go, both of you dead as a couplin'-pin. Smeared all over those rocks. Get me? And me—I'll be sorry the regrettable accident was so naughty and went and happened—and I just got off in time meself. And I'll pinch papa's poke while I'm helping get out the bodies!"

caraccidentrisk


Till now she hadn't believed it. But she dared not glance at the approaching car. It was their interesting guest who steered the Gomez past the other; and he ran rather too near the edge of the road ... so that she looked over, down.

car modelskill


Beaming, he went on, "I'd pull the rough stuff right here, instead of wastin' my time as a cap'n of industry by taking you up to see the scenery in that daisy little gully off the road; but the whole world can see us along here—the hicks in the valley and anybody that happens to sneak along in a car behind us. Shame the way this road curves—see too far along it. Fact, you're giving me a lot of trouble. But you'll give me a kiss, won't you, Gwendolyn?"


He bent down, chuckling. She could feel his bristly chin touch her cheek. She sprang up, struck at him. He raised his hand from the wheel. For a second the car ran without control. He jabbed her back into the seat with his elbow. "Don't try any more monkey-shines, if you know what's good for you," he said, quite peacefully, as he resumed steering.

driverriskgendercar part


She was in a haze, conscious only of her father's hand fondling hers. She heard a quick pit-pit-pit-pit behind them. Car going to pass? She'd have to let it go by. She'd concentrate on finding something she could——

soundonomatopoeia


Then, "Hello, folks. Having a picnic? Who's your little friend in the rompers?" sang out a voice beside them. It was Milt Daggett—the Milt who must be scores of miles ahead. His bug had caught up with them, was running even with them on the broad road.

car model


Chapter X


THE CURIOUS INCIDENT OF THE HILLSIDE ROAD (112-118)


So unexpectedly, so genially, that Claire wondered if he realized what was happening, Milt chuckled to the tough on the running-board, as the two cars ran side by side, "Bound for some place, brother?"

car partrisk


The unwelcome guest looked puzzled. For the first time his china eyes ceased twinkling; and he answered dubiously: "Just gettin' a lift." He sped up the car with the hand-throttle. Milt accelerated equally.

car partriskspeedhitchhiker


Claire roused; wanted to shout. She was palsied afraid that Milt would leave them. The last time she had seen him, she had suggested that leaving them would be a favor.

affectrisk


Her guest growled at her—the words coming through a slit at the corner of his rowdy mouth, "Sit still, or I'll run you over."


Milt innocently babbled on, "Better come ride with me, bo'. More room in this-here handsome coupelet."

car


Then was the rough relieved in his uneasy tender little heart, and his eyes flickered again as he shouted back, not looking at Milt, "Thanks, bub, I'll stick by me friends."


"Oh no; can't lose pleasure of your company. I like your looks. You're a bloomin' little island way off on the dim silver skyline." Claire knitted her brows. She had not seen Milt's rhetoric. "You're an island of Hesperyds or Hesperides. Accent on the bezuzus. Oh, yes, moondream, I think you better come. Haven't decided"—Milt's tone was bland—"whether to kill you or just have you pinched. Miss Boltwood! Switch off your power!"


"If she does," the tough shouted, "I'll run 'em off the bank."


"No, you won't, sweetheart, 'cause why? 'Cause what'll I do to you
afterwards?"


"You won't do nothin', Jack, 'cause I'd gouge your eyes out."


"Why, lovesoul, d' you suppose I'd be talking up as brash as this to a bid, stwong man like oo if I didn't have a gun handy?"


"Yuh, I guess so, lil sunbeam. And before you could shoot, I'd crowd your tin liz into the bank, and jam right into it! I may get killed, but you won't even be a grease-spot!"

metaphor


He was turning the Gomez from its straight course, forcing Milt's bug toward the high bank of earth which walled in the road on the left.

car modeldriver


While Claire was very sick with fear, then more sick with contempt, Milt squealed, "You win!" And he had dropped back. The Gomez was going on alone.

car modelrisk


There was only one thing more for Claire—to jump. And that meant death.


The tough was storming, "Your friend's a crack shot—with his mouth!"


The thin pit-pit-pit was coming again. She looked back. She saw Milt's bug snap forward so fast that on a bump its light wheels were in the air. She saw Milt standing on the right side of the bug holding the wheel with one hand, and the other hand—firm, grim, broad-knuckled hand—outstretched toward the tough, then snatching at his collar.

soundonomatopoeiacar modelspeedcar partskillrisk


The tough's grip was torn from the steering wheel. He was yanked from the running-board. He crunched down on the road.

car part


She seized the wheel. She drove on at sixty miles an hour. She had gone a good mile before she got control of her fear and halted. She saw Milt turn his little car as though it were a prancing bronco. It seemed to paw the air with its front wheels. He shot back, pursuing the late guest. The man ran bobbing along the road. At this distance he was no longer formidable, but a comic, jerking, rabbity figure, humping himself over the back track.

car partaffectspeed


As the bug whirled down on him, the tough was to be seen throwing up his hands, leaping from the high bank.


Milt turned again and came toward them, but slowly; and after he had drawn up even and switched off the engine, he snatched off his violent plaid cap and looked apologetic.

slownessengine


"Sorry I had to kid him along. I was afraid he really would drive you off the bank. He was a bad actor. And he was right; he could have licked me. Thought maybe I could jolly him into getting off, and have him pinched, next town."


"But you had a gun—a revolver—didn't you, lad?" panted Mr. Boltwood.


"Um, wellllll—— I've got a shotgun. It wouldn't take me more 'n five or ten minutes to dig it out, and put it together. And there's some shells. They may be all right. Haven't looked at 'em since last fall. They didn't get so awful damp then."


"But suppose he'd had a revolver himself?" wailed Claire.


"Gee, you know, I thought he probably did have one. I was scared blue. I had a wrench to throw at him though," confided Milt.


"How did you know we needed you?"


"Why back there, couple miles behind you, maybe I saw your father get up and try to wrestle him, so I suspected there was kind of a disagreement. Say, Miss Boltwood, you know when you spoke to me—way back there—I hadn't meant to butt in. Honest. I thought maybe as we were going——"


"Oh, I know!"


"—the same way, you wouldn't mind my trailing, if I didn't sit in too often; and I thought maybe I could help you if——"


"Oh, I know! I'm so ashamed! So bitterly ashamed! I just meant—— Will you forgive me? You were so good, taking care of us——"


"Oh, sure, that's all right!"


"I fancy you do know how grateful father and I are that you were behind us, this time! Wasn't it a lucky accident that we'd slipped past you some place!"


"Yes," dryly, "quite an accident. Well, I'll skip on ahead again. May run into you again before we hit Seattle. Going to take the run through Yellowstone Park?"


"Yes, but——" began Claire. Her father interrupted:


"Uh, Mr., uh—Daggett, was it?—I wonder if you won't stay a little closer to us hereafter? I was getting rather a good change out of the trip, but I'm afraid that now—— If it wouldn't be an insult, I'd beg you to consider staying with us for a consideration, uh, you know, remuneration, and you could——"


"Thanks, uh, thank you, sir, but I wouldn't like to do it. You see, it's kind of my vacation. If I've done anything I'm tickled——"


"But perhaps," Mr. Boltwood ardently begged the young man recently so abysmally unimportant, "perhaps you would consent to being my guest, when you cared to—say at hotels in the Park."


"'Fraid I couldn't. I'm kind of a lone wolf."


"Please! Pretty please!" besought Claire. Her smile was appealing, her eyes on his.


Milt bit his knuckles. He looked weak. But he persisted, "No, you'll get over this scrap with our friend. By the way, I'll put the deputy onto him, in the next town. He'll never get out of the county. When you forget him—— Oh no, you can go on fine. You're a good steady driver, and the road's perfectly safe—if you give people the once-over before you pick 'em up. Picking up badmen is no more dangerous here than it would be in New York. Fact, there's lot more hold-ups in any city than in the wildest country. I don't think you showed such awfully good taste in asking Terrible Tim, the two-gun man, right into the parlor. Gee, please don't do it again! Please!"


"No," meekly. "I was an idiot. I'll be good, next time. But won't you stay somewhere near us?"


"I'd like to, but I got to chase on. Don't want to wear out the welcome on the doormat, and I'm due in Seattle, and—— Say, Miss Boltwood." He swung out of the bug, cranked up, climbed back, went awkwardly on, "I read those books you gave me. They're slick—mean to say, interesting. Where that young fellow in Youth's Encounter wanted to be a bishop and a soldier and everything—— Just like me, except Schoenstrom is different, from London, some ways! I always wanted to be a brakie, and then a yeggman. But I wasn't bright enough for either. I just became a garage man. And I—— Some day I'm going to stop using slang. But it'll take an operation!"

car


He was streaking down the road, and Claire was sobbing, "Oh, the lamb, the darling thing! Fretting about his slang, when he wasn't afraid in that horrible nightmare. If we could just do something for him!"


"Don't you worry about him, dolly. He's a very energetic chap. And—— Uh—— Mightn't we drive on a little farther, perhaps? I confess that the thought of our recent guest still in this vicinity——"


"Yes, and—— Oh, I'm shameless. If Mohammed Milton won't stay with our car mountain, we're going to tag after him."

metaphor


But when she reached the next hill, with its far shining outlook, there was no Milt and no Teal bug on the road ahead.

car modelroad